BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060229.seq (677 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2TGX5 Cluster: Flp-18 GPCR receptor; n=1; Meloidogyne ... 34 2.8 UniRef50_O97278 Cluster: Transporter, putative; n=2; Plasmodium|... 33 8.4 >UniRef50_Q2TGX5 Cluster: Flp-18 GPCR receptor; n=1; Meloidogyne incognita|Rep: Flp-18 GPCR receptor - Meloidogyne incognita (Southern root-knot nematode) Length = 494 Score = 34.3 bits (75), Expect = 2.8 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 449 ICFNVNGLCEISVDRFCIIIFSLKXKFSRIWIFIYLMILFI 571 +CF+ L ISVDRF +I+F + FS +++ F+ Sbjct: 131 LCFSTFTLAAISVDRFLLILFPTRKAFSHTQALFIILVAFL 171 >UniRef50_O97278 Cluster: Transporter, putative; n=2; Plasmodium|Rep: Transporter, putative - Plasmodium falciparum (isolate 3D7) Length = 3133 Score = 32.7 bits (71), Expect = 8.4 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +2 Query: 431 CFYLNIICFNVNGLCEISVDRFCIIIFSLKXKFSRIWIFIYLMILF 568 C ++ ICF++N +I+++ F + K + W+ Y +ILF Sbjct: 587 CLFIVNICFDINKERKINIENFLCCLKINKYYYYYSWLLFYFIILF 632 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,632,589 Number of Sequences: 1657284 Number of extensions: 9155571 Number of successful extensions: 17419 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17419 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -