SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060228.seq
         (642 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    23   1.9  
DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex det...    22   4.4  
DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex det...    22   4.4  
DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex det...    22   4.4  
DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex det...    22   4.4  
DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    22   4.4  
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    22   4.4  
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    22   4.4  
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    22   4.4  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   4.4  
AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase ...    22   5.8  

>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 10/39 (25%), Positives = 21/39 (53%)
 Frame = +1

Query: 307 NIFILIQQNGSKNSFTLEGIWNSIMCDPHYCNSRYLLRL 423
           +I     Q  +K+S+T+ G+  +I    H+C   Y +++
Sbjct: 433 SIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKV 471


>DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +2

Query: 530 HRFHPPISP 556
           +RFHPP++P
Sbjct: 160 YRFHPPLNP 168


>DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +2

Query: 530 HRFHPPISP 556
           +RFHPP++P
Sbjct: 160 YRFHPPLNP 168


>DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +2

Query: 530 HRFHPPISP 556
           +RFHPP++P
Sbjct: 160 YRFHPPLNP 168


>DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +2

Query: 530 HRFHPPISP 556
           +RFHPP++P
Sbjct: 160 YRFHPPLNP 168


>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +2

Query: 530 HRFHPPISP 556
           +RFHPP++P
Sbjct: 164 YRFHPPLNP 172


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +2

Query: 530 HRFHPPISP 556
           +RFHPP++P
Sbjct: 169 YRFHPPLNP 177


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +2

Query: 530 HRFHPPISP 556
           +RFHPP++P
Sbjct: 169 YRFHPPLNP 177


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +2

Query: 530 HRFHPPISP 556
           +RFHPP++P
Sbjct: 169 YRFHPPLNP 177


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +2

Query: 539  HPPISPTNSEEKLH 580
            +P I+P N  EKLH
Sbjct: 1474 YPRINPDNHNEKLH 1487


>AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase
           protein.
          Length = 628

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -2

Query: 287 YCAIWNEII 261
           YCA WNE +
Sbjct: 573 YCAFWNEFL 581


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 158,185
Number of Sequences: 438
Number of extensions: 2977
Number of successful extensions: 11
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19315974
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -