BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060227.seq (492 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58730.1 68416.m06546 vacuolar ATP synthase subunit D (VATD) ... 39 0.002 >At3g58730.1 68416.m06546 vacuolar ATP synthase subunit D (VATD) / V-ATPase D subunit / vacuolar proton pump D subunit (VATPD) identical to Vacuolar ATP synthase subunit D (EC 3.6.3.14) (V-ATPase D subunit) (Vacuolar proton pump D subunit) (Swiss-Prot:Q9XGM1) [Arabidopsis thaliana] Length = 261 Score = 39.1 bits (87), Expect = 0.002 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +3 Query: 249 GXXMXEAAFSLAEAKXTTGX-FNQVVLQNVTKAXIRLGPRRTMXLGVTLPIFESXHXGSD 425 G M ++F+L E K G VVL+NV +A +++ R GV LP F+ G Sbjct: 60 GDMMKTSSFALTEVKYVAGDNVKHVVLENVKEATLKVRSRTENIAGVKLPKFDHFSEGET 119 Query: 426 TYELAXLAPXXXQL 467 +L LA Q+ Sbjct: 120 KNDLTGLARGGQQV 133 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,795,477 Number of Sequences: 28952 Number of extensions: 107172 Number of successful extensions: 141 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -