BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060224.seq (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 8e-19 SB_6317| Best HMM Match : RVT_2 (HMM E-Value=2.5e-14) 64 8e-11 SB_43674| Best HMM Match : RVT_2 (HMM E-Value=2.5e-14) 64 8e-11 SB_59345| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_2808| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19681| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_29110| Best HMM Match : rve (HMM E-Value=2.1e-08) 41 8e-04 SB_55915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_13256| Best HMM Match : rve (HMM E-Value=1.1e-17) 41 8e-04 SB_24294| Best HMM Match : RVT_2 (HMM E-Value=0) 40 0.001 SB_45349| Best HMM Match : rve (HMM E-Value=6.1e-31) 39 0.003 SB_31556| Best HMM Match : rve (HMM E-Value=4.7e-30) 39 0.003 SB_47875| Best HMM Match : rve (HMM E-Value=3.3e-16) 39 0.004 SB_29251| Best HMM Match : rve (HMM E-Value=2.3e-29) 37 0.017 SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) 37 0.017 SB_59639| Best HMM Match : Ribosomal_S25 (HMM E-Value=3.2) 36 0.030 SB_39528| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_25312| Best HMM Match : Vicilin_N (HMM E-Value=0.61) 36 0.030 SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_34095| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_4460| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_37763| Best HMM Match : rve (HMM E-Value=4.2e-27) 34 0.092 SB_20716| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.092 SB_39489| Best HMM Match : rve (HMM E-Value=1.7e-20) 34 0.092 SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.12 SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_9750| Best HMM Match : rve (HMM E-Value=1.2e-37) 34 0.12 SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.12 SB_38577| Best HMM Match : rve (HMM E-Value=2.4e-24) 34 0.12 SB_56941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_55817| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) 33 0.16 SB_43121| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) 33 0.16 SB_34135| Best HMM Match : rve (HMM E-Value=3e-29) 33 0.16 SB_33992| Best HMM Match : rve (HMM E-Value=6e-35) 33 0.16 SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) 33 0.16 SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32) 33 0.16 SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) 33 0.16 SB_12161| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_3512| Best HMM Match : rve (HMM E-Value=4.7e-35) 33 0.16 SB_1340| Best HMM Match : rve (HMM E-Value=3.1e-14) 33 0.16 SB_58163| Best HMM Match : rve (HMM E-Value=9e-32) 33 0.16 SB_54615| Best HMM Match : rve (HMM E-Value=4.4e-25) 33 0.16 SB_54590| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27) 33 0.16 SB_48888| Best HMM Match : rve (HMM E-Value=6.4e-33) 33 0.16 SB_45153| Best HMM Match : rve (HMM E-Value=0) 33 0.16 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 33 0.16 SB_39379| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_31807| Best HMM Match : rve (HMM E-Value=4.4e-25) 33 0.16 SB_30480| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_29849| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_27863| Best HMM Match : rve (HMM E-Value=4.7e-35) 33 0.16 SB_27381| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_25999| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_24280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_12609| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_12601| Best HMM Match : rve (HMM E-Value=5e-29) 33 0.16 SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_6912| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.16 SB_5291| Best HMM Match : rve (HMM E-Value=2.3e-35) 33 0.16 SB_3768| Best HMM Match : Involucrin (HMM E-Value=0.021) 33 0.16 SB_39899| Best HMM Match : rve (HMM E-Value=5.9e-27) 33 0.21 SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_10923| Best HMM Match : rve (HMM E-Value=0.0014) 33 0.21 SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_3315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) 33 0.21 SB_48097| Best HMM Match : rve (HMM E-Value=2.6e-17) 33 0.21 SB_26036| Best HMM Match : rve (HMM E-Value=0.00011) 33 0.21 SB_25583| Best HMM Match : rve (HMM E-Value=5.9e-05) 33 0.21 SB_9257| Best HMM Match : RVT_1 (HMM E-Value=9.1e-32) 33 0.21 SB_1797| Best HMM Match : rve (HMM E-Value=8.5e-35) 33 0.21 SB_58082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_36906| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_52193| Best HMM Match : rve (HMM E-Value=5.8e-20) 33 0.28 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 32 0.37 SB_59085| Best HMM Match : rve (HMM E-Value=0.00048) 32 0.49 SB_58301| Best HMM Match : DUF1168 (HMM E-Value=7.6) 32 0.49 SB_53108| Best HMM Match : DUF1168 (HMM E-Value=7.1) 32 0.49 SB_52251| Best HMM Match : rve (HMM E-Value=1.1e-34) 32 0.49 SB_50945| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_49359| Best HMM Match : rve (HMM E-Value=5.5e-37) 32 0.49 SB_48772| Best HMM Match : rve (HMM E-Value=4.2e-35) 32 0.49 SB_45195| Best HMM Match : rve (HMM E-Value=0.56) 32 0.49 SB_40370| Best HMM Match : rve (HMM E-Value=1.3e-37) 32 0.49 SB_36737| Best HMM Match : rve (HMM E-Value=1.4e-38) 32 0.49 SB_28729| Best HMM Match : rve (HMM E-Value=1.4e-38) 32 0.49 SB_15656| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_14178| Best HMM Match : rve (HMM E-Value=1.4e-38) 32 0.49 SB_13901| Best HMM Match : rve (HMM E-Value=5.5e-29) 32 0.49 SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27) 32 0.49 SB_2953| Best HMM Match : DUF1168 (HMM E-Value=7.6) 32 0.49 SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25) 32 0.49 SB_56290| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_52339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_42915| Best HMM Match : rve (HMM E-Value=1.4e-38) 32 0.49 SB_39760| Best HMM Match : rve (HMM E-Value=1.1e-29) 32 0.49 SB_39602| Best HMM Match : rve (HMM E-Value=1.4e-38) 32 0.49 SB_31504| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_30319| Best HMM Match : rve (HMM E-Value=1.2e-37) 32 0.49 SB_19168| Best HMM Match : rve (HMM E-Value=3.9e-38) 32 0.49 SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18) 32 0.49 SB_14976| Best HMM Match : rve (HMM E-Value=1.3e-38) 32 0.49 SB_10281| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_9047| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19) 32 0.49 SB_8981| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_4255| Best HMM Match : rve (HMM E-Value=1.4e-38) 32 0.49 SB_3392| Best HMM Match : rve (HMM E-Value=1.4e-38) 32 0.49 SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.65 SB_39756| Best HMM Match : Ribosomal_S25 (HMM E-Value=2.6) 31 0.65 SB_37558| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_16047| Best HMM Match : rve (HMM E-Value=2e-12) 31 0.65 SB_13442| Best HMM Match : rve (HMM E-Value=2.3e-13) 31 0.65 SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_51361| Best HMM Match : rve (HMM E-Value=6.4e-14) 31 0.65 SB_10363| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_2192| Best HMM Match : rve (HMM E-Value=4e-23) 31 0.65 SB_58283| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_54349| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_36817| Best HMM Match : rve (HMM E-Value=6.2e-36) 31 0.86 SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_21678| Best HMM Match : rve (HMM E-Value=2e-36) 31 1.1 SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_25556| Best HMM Match : rve (HMM E-Value=2.8e-17) 31 1.1 SB_23039| Best HMM Match : rve (HMM E-Value=2.8e-20) 31 1.1 SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.5 SB_18798| Best HMM Match : rve (HMM E-Value=2.2e-20) 30 1.5 SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 30 1.5 SB_40189| Best HMM Match : rve (HMM E-Value=1.4e-08) 30 2.0 SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_8339| Best HMM Match : rve (HMM E-Value=5.4e-31) 30 2.0 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_31709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_25425| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_59388| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_17283| Best HMM Match : rve (HMM E-Value=2.5e-35) 29 2.6 SB_13623| Best HMM Match : rve (HMM E-Value=0.00044) 29 2.6 SB_51339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_46540| Best HMM Match : RVT_1 (HMM E-Value=4.8e-27) 29 3.5 SB_30755| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_46587| Best HMM Match : rve (HMM E-Value=1e-04) 29 4.6 SB_44798| Best HMM Match : rve (HMM E-Value=3.4e-33) 29 4.6 SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_14677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_44253| Best HMM Match : rve (HMM E-Value=8.4e-10) 29 4.6 SB_37291| Best HMM Match : rve (HMM E-Value=4.8e-19) 29 4.6 SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) 29 4.6 SB_25012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55617| Best HMM Match : GPW_gp25 (HMM E-Value=9.5) 28 6.0 SB_59190| Best HMM Match : rve (HMM E-Value=6e-18) 28 8.0 SB_57305| Best HMM Match : rve (HMM E-Value=6.6e-22) 28 8.0 SB_43123| Best HMM Match : rve (HMM E-Value=6e-18) 28 8.0 SB_39709| Best HMM Match : rve (HMM E-Value=6e-18) 28 8.0 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) 28 8.0 SB_30312| Best HMM Match : rve (HMM E-Value=5.6e-15) 28 8.0 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 28 8.0 SB_25327| Best HMM Match : rve (HMM E-Value=6.6e-22) 28 8.0 SB_19527| Best HMM Match : rve (HMM E-Value=1e-20) 28 8.0 SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_12365| Best HMM Match : rve (HMM E-Value=0.00031) 28 8.0 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 8.0 SB_5129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_4292| Best HMM Match : rve (HMM E-Value=0.0023) 28 8.0 SB_55004| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 8.0 SB_51753| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 8.0 SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) 28 8.0 SB_46176| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 8.0 SB_46067| Best HMM Match : rve (HMM E-Value=6e-18) 28 8.0 SB_45972| Best HMM Match : Ribosomal_L21e (HMM E-Value=9) 28 8.0 SB_34611| Best HMM Match : rve (HMM E-Value=6.6e-22) 28 8.0 SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17) 28 8.0 SB_25480| Best HMM Match : rve (HMM E-Value=6.6e-22) 28 8.0 SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) 28 8.0 SB_16064| Best HMM Match : rve (HMM E-Value=6.6e-22) 28 8.0 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 28 8.0 >SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 91.1 bits (216), Expect = 8e-19 Identities = 37/76 (48%), Positives = 56/76 (73%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 + + G++ Q + P TPEQNG++E+MNR+LVE + ML +A L ++W EA++TA Y+ NR Sbjct: 284 LKSEGVRRQLTIPKTPEQNGVAERMNRTLVETVRSMLADADLPPMFWPEALSTAVYLRNR 343 Query: 204 SPSRVLAEVTPYEKWT 251 SP++ L +TPYE WT Sbjct: 344 SPTKALKYMTPYESWT 359 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/74 (44%), Positives = 44/74 (59%) Frame = +2 Query: 257 KPNISHLRIFGSKAMVHVPKQNRLKWDRKSQELVFVGYCENTKGYRLIDPNSKKAVISRD 436 KPN+ HLR FG A HVPK R K D K+++ + +GY E TKGYRL DP + SR+ Sbjct: 362 KPNVEHLRTFGCTAYAHVPKDERKKLDSKAKKCILLGYGEETKGYRLYDPEKRLVFYSRN 421 Query: 437 VIFIESSIDNVTQK 478 V+ E V ++ Sbjct: 422 VVLSEEKEGEVKEE 435 >SB_6317| Best HMM Match : RVT_2 (HMM E-Value=2.5e-14) Length = 813 Score = 64.5 bits (150), Expect = 8e-11 Identities = 30/75 (40%), Positives = 48/75 (64%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPS 212 +GI H+ S P +P QNG +E+ R+L E +C+L ++ + + +W AV+ AAYI NR + Sbjct: 130 NGINHRKSCPNSPHQNGTAERHWRTLFEMGRCLLTQSNVSREFWPYAVSAAAYIRNRCFN 189 Query: 213 RVLAEVTPYEKWTSR 257 + L + TPY+ T R Sbjct: 190 KRLQQ-TPYQAMTGR 203 Score = 44.8 bits (101), Expect = 7e-05 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Frame = +2 Query: 257 KPNISHLRIFGSKAMVHVPKQNRLKWDRKSQELVFVGYCENTKGYRLIDPNSKKAVISRD 436 KPN+S++R+FGS+ + KQ + K D + + VF+GY + + Y + P + K R Sbjct: 204 KPNLSNMRVFGSECFAY--KQMKKKLDDRCTKGVFLGYDKGSLSYLVYIPEANKVRKYRV 261 Query: 437 VIF-IESSIDNVTQKPSLKP 493 V F +S ++ TQ L P Sbjct: 262 VKFPTKSVVEQQTQTDGLLP 281 >SB_43674| Best HMM Match : RVT_2 (HMM E-Value=2.5e-14) Length = 813 Score = 64.5 bits (150), Expect = 8e-11 Identities = 30/75 (40%), Positives = 48/75 (64%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPS 212 +GI H+ S P +P QNG +E+ R+L E +C+L ++ + + +W AV+ AAYI NR + Sbjct: 130 NGINHRKSCPNSPHQNGTAERHWRTLFEMGRCLLTQSNVSREFWPYAVSAAAYIRNRCFN 189 Query: 213 RVLAEVTPYEKWTSR 257 + L + TPY+ T R Sbjct: 190 KRLQQ-TPYQAMTGR 203 Score = 44.8 bits (101), Expect = 7e-05 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Frame = +2 Query: 257 KPNISHLRIFGSKAMVHVPKQNRLKWDRKSQELVFVGYCENTKGYRLIDPNSKKAVISRD 436 KPN+S++R+FGS+ + KQ + K D + + VF+GY + + Y + P + K R Sbjct: 204 KPNLSNMRVFGSECFAY--KQMKKKLDDRCTKGVFLGYDKGSLSYLVYIPEANKVRKYRV 261 Query: 437 VIF-IESSIDNVTQKPSLKP 493 V F +S ++ TQ L P Sbjct: 262 VKFPTKSVVEQQTQTDGLLP 281 >SB_59345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/56 (42%), Positives = 35/56 (62%) Frame = +3 Query: 72 EQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTPY 239 ++NG +E+ R+L E +C+L E ++ K W AV TAA+I NR +R E TPY Sbjct: 423 DKNGTAERQWRTLFEMGRCLLIEKQVPKFLWPYAVQTAAHIRNRCYNR-RTENTPY 477 Score = 42.3 bits (95), Expect = 3e-04 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Frame = +2 Query: 257 KPNISHLRIFGSKAMVHVPKQNRLKWDRKSQELVFVGYCENTKGYRLIDPNSKKAVISRD 436 KP++S + IFGS+ + N K D + VFVGY +N+ Y + P+ K + R Sbjct: 484 KPDLSRMGIFGSECYTY--NHNHKKLDSRGVRGVFVGYDKNSPAYLVYHPDKGKVLKHRL 541 Query: 437 VIFI-ESSIDNVTQKPSL 487 + FI + I+ TQ L Sbjct: 542 IKFISKDCIEQETQTEGL 559 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = +2 Query: 320 NRLKWDRKSQELVFVGYCENTKGYRLIDPNSKKAVISRDVIFIESSIDNV-TQKPSLKPQ 496 N K D K+++ + +GY E TK YRL P ++ SR+V++ E D + +++ L+P Sbjct: 2 NEKKLDSKAKKFILLGYGEETKRYRLYAPKKRRVFYSRNVVYNEHKEDKIKSRRTILRPV 61 Query: 497 LITLL 511 +LL Sbjct: 62 CTSLL 66 >SB_2808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCML-FEAKLQKIYWAEAVATAAYIINRSP 209 +GI+ +P TP GL E+ NR+ E + +L EA + W E+ + A+Y +N + Sbjct: 152 NGIQISHGSPRTPTAQGLVERSNRTFKEDLRAILQSEAHKELKRWCESTSQASYTVNITH 211 Query: 210 SRVLAEVTPYE 242 R + E TPYE Sbjct: 212 HRAINE-TPYE 221 >SB_19681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEA 173 +GI H S P +P QNG +E+ R+L E +C+L + + + +W A Sbjct: 731 NGINHSKSCPNSPYQNGTAERHWRTLSEMGRCLLTQGNVSREFWPYA 777 >SB_29110| Best HMM Match : rve (HMM E-Value=2.1e-08) Length = 404 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +2 Query: 323 RLKWDRKSQELVFVGYCENTKGYRLIDPNSKKAVISRDVIFIESSIDNVTQK 478 R K D K+++ +FVGY K Y+L D + K V+SR+V F E ++ +K Sbjct: 184 RKKLDAKARKAIFVGYPTGVKRYKLYDIDKKCFVVSRNVQFAEDRFNHFDRK 235 Score = 31.5 bits (68), Expect = 0.65 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRS 107 GI + + P++PEQNG+++++NR+ Sbjct: 158 GIGRELTTPHSPEQNGVAKRLNRT 181 >SB_55915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 41.1 bits (92), Expect = 8e-04 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCML-FEAKLQKIYWAEAVATAAYIINRSP 209 +GI+ +P P GL E+ NR+ E + +L EA + W E+ + A+Y +N + Sbjct: 49 NGIQISHGSPRMPTTQGLVERSNRTFKEDLRAILQSEAHKEMKRWCESTSQASYTMNITH 108 Query: 210 SRVLAEVTPYE 242 R + E TPYE Sbjct: 109 HRAMNE-TPYE 118 >SB_13256| Best HMM Match : rve (HMM E-Value=1.1e-17) Length = 321 Score = 41.1 bits (92), Expect = 8e-04 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCML-FEAKLQKIYWAEAVATAAYIINRSP 209 +GI+ +P P GL E+ NR+ E + +L EA + W E+ + A+Y +N + Sbjct: 115 NGIQISHGSPRMPTTQGLVERSNRTFKEDLRAILQSEAHKEMKRWCESTSQASYTMNITH 174 Query: 210 SRVLAEVTPYE 242 R + E TPYE Sbjct: 175 HRAMNE-TPYE 184 >SB_24294| Best HMM Match : RVT_2 (HMM E-Value=0) Length = 627 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +2 Query: 260 PNISHLRIFGSKAMVHVPKQNRLKWDRKSQELV 358 PN+ HLR FG A HVPK R K D K+++ + Sbjct: 187 PNVEHLRTFGCTAYAHVPKDERKKLDSKAKKCI 219 >SB_45349| Best HMM Match : rve (HMM E-Value=6.1e-31) Length = 298 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAK 146 E R + GI+H+TS P P+ NG E+ NR+L++ K E K Sbjct: 106 EEFTRYLRECGIEHRTSPPLWPQANGEVERQNRTLLKALKIAAVEGK 152 >SB_31556| Best HMM Match : rve (HMM E-Value=4.7e-30) Length = 322 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCML-FEAKLQKIYWAEAVATAAYIINRSP 209 +GI+ +P P GL E+ NR+ E + + EA + W E+ + A+Y +N + Sbjct: 213 NGIQISHGSPRKPTTQGLVERSNRTFKEDLRAIFQSEAHKELKRWCESTSQASYTMNITH 272 Query: 210 SRVLAEVTPYE 242 R + E TPYE Sbjct: 273 HRAINE-TPYE 282 >SB_47875| Best HMM Match : rve (HMM E-Value=3.3e-16) Length = 488 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCML-FEAKLQKIYWAEAVATAAYIINRSP 209 +GI+ P P GL ++ NR+ E + +L EA + W E+ + A+Y +N + Sbjct: 334 NGIQISHGLPRMPTTQGLVKRSNRTFKEDLRAILQSEAHKEMKRWCESTSQASYTMNITH 393 Query: 210 SRVLAEVTPYE 242 R + E TPYE Sbjct: 394 HRAINE-TPYE 403 >SB_29251| Best HMM Match : rve (HMM E-Value=2.3e-29) Length = 324 Score = 36.7 bits (81), Expect = 0.017 Identities = 21/70 (30%), Positives = 35/70 (50%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPS 212 + IK +P TP GL E+ NR+ E + +L + W +A A+Y +N + Sbjct: 247 NNIKICHGSPRTPTTQGLVERSNRTWKEDMRAILISKQKSVGEWCKATMEASYTMNITYH 306 Query: 213 RVLAEVTPYE 242 R + + +PYE Sbjct: 307 RAI-KCSPYE 315 >SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) Length = 2581 Score = 36.7 bits (81), Expect = 0.017 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 +G+ H + PY P+ NGL E+MNR+L+ + + ++ K W + V + N Sbjct: 17 TGVMHSRTTPYHPQGNGLVERMNRTLLGMMRTL---PEMYKSNWKDHVHKLVHAYN 69 >SB_59639| Best HMM Match : Ribosomal_S25 (HMM E-Value=3.2) Length = 576 Score = 35.9 bits (79), Expect = 0.030 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +3 Query: 69 PEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTPYE 242 P GL E+ NR+ + + EA + W E+ + A+Y +N + R + E TPYE Sbjct: 2 PTTQGLVERSNRTFKDLRAILQSEAHKEMKRWCESTSQASYTMNITHHRAINE-TPYE 58 >SB_39528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1029 Score = 35.9 bits (79), Expect = 0.030 Identities = 19/62 (30%), Positives = 32/62 (51%) Frame = +3 Query: 57 APYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTP 236 +P TP GL E+ NR+ E + +L + W +A A+Y +N + R + + +P Sbjct: 807 SPRTPTTQGLVERSNRTWKEDMRAILISKQKSVGEWCKATMEASYTMNITYHRAI-KCSP 865 Query: 237 YE 242 YE Sbjct: 866 YE 867 >SB_25312| Best HMM Match : Vicilin_N (HMM E-Value=0.61) Length = 219 Score = 35.9 bits (79), Expect = 0.030 Identities = 19/62 (30%), Positives = 32/62 (51%) Frame = +3 Query: 57 APYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTP 236 +P TP GL E+ NR+ E + +L + W +A A+Y +N + R + + +P Sbjct: 30 SPRTPTTQGLVERSNRTWKEDMRAILISKQKSVGEWCKATMEASYTMNITYHRAI-KCSP 88 Query: 237 YE 242 YE Sbjct: 89 YE 90 >SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1957 Score = 35.9 bits (79), Expect = 0.030 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 18 RQIHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAK 146 R + GI+H+ S P P+ NG E+ NR+L++ K E K Sbjct: 1756 RYLRECGIEHRISPPLWPQANGEVERQNRTLLKALKIAAVEGK 1798 >SB_34095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 465 Score = 35.5 bits (78), Expect = 0.040 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSP 209 GIK + PY P+ NG E+ NRSL + + + + K + W E + Y N +P Sbjct: 203 GIKKSRTTPYHPQGNGQCERFNRSLHDLLRTLPADKKRR---WPEHLKEICYGYNATP 257 >SB_4460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 685 Score = 35.5 bits (78), Expect = 0.040 Identities = 22/57 (38%), Positives = 30/57 (52%) Frame = +3 Query: 72 EQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTPYE 242 E N +RS V RA + A++ K + EA TA Y+ NRSP+ L TP+E Sbjct: 345 EGNAHLTTCDRSCV-RATQSVIRAQVNKEFTLEACNTAVYLHNRSPTAALDNGTPFE 400 Score = 31.9 bits (69), Expect = 0.49 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 257 KPNISHLRIFGSKAMVHVPKQNRLKWDRKSQ 349 KPN+SHL+ FG + + P+ R K D K++ Sbjct: 406 KPNVSHLKKFGCVSYEYAPRCQRKKLDAKAR 436 >SB_37763| Best HMM Match : rve (HMM E-Value=4.2e-27) Length = 510 Score = 34.3 bits (75), Expect = 0.092 Identities = 16/63 (25%), Positives = 32/63 (50%) Frame = +3 Query: 54 SAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVT 233 S+ Y+P+ G E+ +R+ E+ + + E + + W E + + N SP L ++ Sbjct: 285 SSAYSPQTQGKDERSHRTWKEKIRFDMLECE-DGLNWVERLPVYQQLYNESPHSSLGMLS 343 Query: 234 PYE 242 P+E Sbjct: 344 PFE 346 >SB_20716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 34.3 bits (75), Expect = 0.092 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 179 EAFAKFMKQNGVKHTTTAPYHPKSNGQAER 208 >SB_39489| Best HMM Match : rve (HMM E-Value=1.7e-20) Length = 203 Score = 34.3 bits (75), Expect = 0.092 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQ 152 +GIKH TSAP P NG +E+ R+ E K + KL+ Sbjct: 145 NGIKHTTSAPKHPASNGFAERYVRTFKETMKKWRGKGKLR 184 >SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1020 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 SG+ H + PY P+ NG E+ N++L+ + + + QK W +++ + N Sbjct: 646 SGVAHSRTTPYHPQSNGQVERFNQTLLAMLRTL---PENQKSKWKDSLNKVVHAYN 698 >SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1038 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAK-LQK 155 + ++GIK ++ P P+ NGL E+ NRS+ + K E K LQK Sbjct: 946 LRSNGIKWVSTTPLWPQANGLVERTNRSIEKILKIATVEKKDLQK 990 >SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 33.9 bits (74), Expect = 0.12 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAK-LQKIYWAEAVA-TAAYII 197 + ++GIK ++ P P+ NGL E+ NR++ + K E K LQK + VA + YI Sbjct: 1042 LKSNGIKWVSTTPLWPQANGLVERTNRTIEKILKITTVEKKDLQKGFRKFLVAYRSVYIR 1101 Query: 198 NRSPSRVLAEVTPY 239 + VL + Y Sbjct: 1102 KPKHAVVLTDSNEY 1115 >SB_9750| Best HMM Match : rve (HMM E-Value=1.2e-37) Length = 280 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 SG+ H + PY P+ NG E+ N++L+ + + + QK W +++ + N Sbjct: 120 SGVAHSRTTPYHPQSNGQVERFNQTLLAMLRTL---PENQKSKWKDSLNKVVHAYN 172 >SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1623 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 SG+ H + PY P+ NG E+ N++L+ + + + QK W +++ + N Sbjct: 1463 SGVAHSRTTPYHPQSNGQVERFNQTLLAMLRTL---PENQKSKWKDSLNKVVHAYN 1515 >SB_38577| Best HMM Match : rve (HMM E-Value=2.4e-24) Length = 205 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 SG+ H + PY P+ NG E+ N++L+ + + + QK W +++ + N Sbjct: 72 SGVAHSRTTPYHPQSNGQVERFNQTLLAMLRTL---PENQKSNWKDSLNKVVHAYN 124 >SB_56941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1034 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 566 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 598 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 1079 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 1111 >SB_55817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 980 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLV 113 G++H + PY PE NG E+ NR+L+ Sbjct: 369 GVRHSRTTPYHPEGNGQVERFNRTLL 394 >SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) Length = 622 Score = 33.5 bits (73), Expect = 0.16 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +3 Query: 66 TPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTPYE 242 TP GL E+ NR+ E + +L + W +A A+Y +N + R + + +PYE Sbjct: 339 TPTTQGLVERSNRTWKEDMRAILISKQKSVGEWCKATMEASYTMNITYHRAI-KCSPYE 396 >SB_43121| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) Length = 1037 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 974 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 1006 >SB_34135| Best HMM Match : rve (HMM E-Value=3e-29) Length = 324 Score = 33.5 bits (73), Expect = 0.16 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +3 Query: 66 TPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTPYE 242 TP GL E+ NR+ E + +L + W +A A+Y +N + R + + +PYE Sbjct: 258 TPTTQGLVERSNRTWKEDMRAILISKQKSVGEWCKATMEASYTMNITYHRAI-KCSPYE 315 >SB_33992| Best HMM Match : rve (HMM E-Value=6e-35) Length = 285 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 145 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 177 >SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 704 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 736 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 362 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 394 >SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) Length = 1602 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 1016 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 1048 >SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32) Length = 1556 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 1316 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 1348 >SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) Length = 2376 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLV 113 G++H + PY PE NG E+ NR+L+ Sbjct: 1666 GVRHSRTTPYHPEGNGQVERFNRTLL 1691 >SB_12161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 11 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 43 >SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1514 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 1057 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 1089 >SB_3512| Best HMM Match : rve (HMM E-Value=4.7e-35) Length = 1073 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 519 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 551 >SB_1340| Best HMM Match : rve (HMM E-Value=3.1e-14) Length = 825 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 625 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 657 >SB_58163| Best HMM Match : rve (HMM E-Value=9e-32) Length = 355 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 130 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 162 >SB_54615| Best HMM Match : rve (HMM E-Value=4.4e-25) Length = 460 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = +3 Query: 39 IKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRV 218 I AP P GL E+ NR + E ++ E L W + + AAY N + R Sbjct: 249 IPQARGAPRNPSAQGLVERANRLVKENLLSLIKEKGLASNDWCKFLNEAAYKKNITLHRA 308 Query: 219 LAEVTPYE 242 + + +PYE Sbjct: 309 IGK-SPYE 315 >SB_54590| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1309 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 1069 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 1101 >SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27) Length = 1068 Score = 33.5 bits (73), Expect = 0.16 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +3 Query: 66 TPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTPYE 242 TP GL E+ NR+ E + +L + W +A A+Y +N + R + + +PYE Sbjct: 439 TPTTQGLVERSNRTWKEDMRAILISKQKSVGEWCKATMEASYTMNITYHRAI-KCSPYE 496 >SB_48888| Best HMM Match : rve (HMM E-Value=6.4e-33) Length = 566 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 400 EAFDKFMKQNGVKHTTTAPYLPKSNGQAER 429 >SB_45153| Best HMM Match : rve (HMM E-Value=0) Length = 2264 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 978 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 1010 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 1994 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 2026 >SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) Length = 1845 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 932 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 964 >SB_39379| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 285 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 145 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 177 >SB_31807| Best HMM Match : rve (HMM E-Value=4.4e-25) Length = 460 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = +3 Query: 39 IKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRV 218 I AP P GL E+ NR + E ++ E L W + + AAY N + R Sbjct: 249 IPQARGAPRNPSAQGLVERANRLVKENLLSLIKEKGLASNDWCKFLNEAAYKKNITLHRA 308 Query: 219 LAEVTPYE 242 + + +PYE Sbjct: 309 IGK-SPYE 315 >SB_30480| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 302 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 221 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 253 >SB_29849| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 494 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 343 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 375 >SB_27863| Best HMM Match : rve (HMM E-Value=4.7e-35) Length = 742 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 130 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 162 >SB_27381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1392 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 802 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 834 >SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEK 95 +GI+H TSAPY P NGL+E+ Sbjct: 1279 NGIRHITSAPYHPSTNGLTER 1299 >SB_25999| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 419 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 221 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 253 >SB_24280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 1060 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 1092 >SB_12609| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 623 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 483 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 515 >SB_12601| Best HMM Match : rve (HMM E-Value=5e-29) Length = 568 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 505 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 537 >SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1520 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 1282 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 1314 >SB_6912| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 440 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 186 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 218 >SB_5291| Best HMM Match : rve (HMM E-Value=2.3e-35) Length = 426 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ E K M Sbjct: 186 NGIKHITSAPKHPASNGFAERYVRTFKETMKKM 218 >SB_3768| Best HMM Match : Involucrin (HMM E-Value=0.021) Length = 205 Score = 33.5 bits (73), Expect = 0.16 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +3 Query: 66 TPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTPYE 242 TP GL E+ NR+ E + +L + W +A A+Y +N + R + + +PYE Sbjct: 33 TPTTQGLVERSNRTWKEDMRAILISKQKSVGEWCKATMEASYTMNITYHRAI-KCSPYE 90 >SB_39899| Best HMM Match : rve (HMM E-Value=5.9e-27) Length = 427 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 317 EAFDKFMKQNGVKHTTTAPYHPKSNGQAER 346 >SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1551 Score = 33.1 bits (72), Expect = 0.21 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 SG+ H + PY P+ NG E+ N++L+ + + + QK W +++ + N Sbjct: 346 SGVAHSRTTPYHPQSNGQVERFNQTLLAMLRTL---PENQKSKWKDSLNKVVHPYN 398 >SB_10923| Best HMM Match : rve (HMM E-Value=0.0014) Length = 147 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 37 EAFDKFMKQNGVKHTTTAPYHPKSNGQAER 66 >SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2309 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 943 EAFDKFMKQNGVKHTTTAPYHPKSNGQAER 972 >SB_3315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 204 EAFDKFMKQNGVKHTTTAPYHPKSNGQAER 233 >SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) Length = 877 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 726 EAFDKFMKQNGVKHTTTAPYHPKSNGQAER 755 >SB_48097| Best HMM Match : rve (HMM E-Value=2.6e-17) Length = 169 Score = 33.1 bits (72), Expect = 0.21 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 21 QIH-ASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 Q+H SG+ + PY P NG E+MNR+L+ K + Sbjct: 67 QLHKVSGVSKSRTTPYHPMGNGKVERMNRTLLSMLKIL 104 >SB_26036| Best HMM Match : rve (HMM E-Value=0.00011) Length = 230 Score = 33.1 bits (72), Expect = 0.21 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = +3 Query: 18 RQIHAS-GIKHQTSAPYTPEQNGLSE---KMNRSLVERA 122 RQ A G KH TSAPY P+ NG +E K+ +S++++A Sbjct: 48 RQFSADYGFKHTTSAPYHPKGNGRAEAAVKVAKSMLKKA 86 >SB_25583| Best HMM Match : rve (HMM E-Value=5.9e-05) Length = 163 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 37 EAFDKFMKQNGVKHTTTAPYHPKSNGQAER 66 >SB_9257| Best HMM Match : RVT_1 (HMM E-Value=9.1e-32) Length = 1086 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 916 EAFDKFMKQNGVKHTTTAPYHPKSNGQAER 945 >SB_1797| Best HMM Match : rve (HMM E-Value=8.5e-35) Length = 285 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ NG +E+ Sbjct: 175 EAFDKFMKQNGVKHTTTAPYHPKSNGQAER 204 >SB_58082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/79 (26%), Positives = 35/79 (44%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 + A GI + PY P NG E+ N + + + L + L W + + A + I R Sbjct: 863 LSARGIASSRTTPYHPIGNGQVERYNGIIWKAVQLALKSSNLPVTKWEQMLPDALHSI-R 921 Query: 204 SPSRVLAEVTPYEKWTSRN 260 S TP+E++ + N Sbjct: 922 SLLCTSTNTTPHERFFTSN 940 >SB_36906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 32.7 bits (71), Expect = 0.28 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 4/75 (5%) Frame = +3 Query: 30 ASGIKHQTSAPYTP---EQNGLSEKMNRSLVERAKCML-FEAKLQKIYWAEAVATAAYII 197 A+ I H T Y + GL E+ NR+ E + +L EA + W E+ + A+Y + Sbjct: 329 ANIIDHHTKFCYMQPIYSKTGLVERSNRTFKEDLRAILQSEAHKELKRWCESTSQASYTM 388 Query: 198 NRSPSRVLAEVTPYE 242 N + R + E PYE Sbjct: 389 NITHHRAINE-RPYE 402 >SB_52193| Best HMM Match : rve (HMM E-Value=5.8e-20) Length = 353 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVE 116 +H +GIKH PY P+ NG +E+ R + E Sbjct: 167 MHTNGIKHTLVPPYHPQSNGAAERSVRVVKE 197 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 32.3 bits (70), Expect = 0.37 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAK 125 + A G+K ++ P P+ NGL E+ NRS+++ K Sbjct: 786 LRAGGVKWLSTTPLWPQANGLVERTNRSILKVLK 819 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 32.3 bits (70), Expect = 0.37 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAK 125 + A G+K ++ P P+ NGL E+ NRS+++ K Sbjct: 507 LRAGGVKWLSTTPLWPQANGLVERTNRSILKVLK 540 >SB_59085| Best HMM Match : rve (HMM E-Value=0.00048) Length = 276 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 33 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 75 >SB_58301| Best HMM Match : DUF1168 (HMM E-Value=7.6) Length = 253 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 10 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 52 >SB_53108| Best HMM Match : DUF1168 (HMM E-Value=7.1) Length = 253 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 10 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 52 >SB_52251| Best HMM Match : rve (HMM E-Value=1.1e-34) Length = 863 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 620 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 662 >SB_50945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 579 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 621 >SB_49359| Best HMM Match : rve (HMM E-Value=5.5e-37) Length = 971 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 790 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 832 >SB_48772| Best HMM Match : rve (HMM E-Value=4.2e-35) Length = 494 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 342 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 384 >SB_45195| Best HMM Match : rve (HMM E-Value=0.56) Length = 263 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 20 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 62 >SB_40370| Best HMM Match : rve (HMM E-Value=1.3e-37) Length = 1393 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 1150 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 1192 >SB_36737| Best HMM Match : rve (HMM E-Value=1.4e-38) Length = 358 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 115 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 157 >SB_28729| Best HMM Match : rve (HMM E-Value=1.4e-38) Length = 374 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 131 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 173 >SB_15656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 892 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 934 >SB_14178| Best HMM Match : rve (HMM E-Value=1.4e-38) Length = 283 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 131 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 173 >SB_13901| Best HMM Match : rve (HMM E-Value=5.5e-29) Length = 202 Score = 31.9 bits (69), Expect = 0.49 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVE 116 GI+H+ PY P+ NG E+ NR++++ Sbjct: 131 GIEHKKGVPYWPQSNGEVERCNRTILK 157 >SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27) Length = 1154 Score = 31.9 bits (69), Expect = 0.49 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEK 95 +GI H+T+APY P NGL+E+ Sbjct: 879 NGIIHKTTAPYHPASNGLAER 899 >SB_2953| Best HMM Match : DUF1168 (HMM E-Value=7.6) Length = 253 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 10 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 52 >SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25) Length = 440 Score = 31.9 bits (69), Expect = 0.49 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLV 113 SG+ H + PY P+ NG E+ N++L+ Sbjct: 359 SGVAHSRTTPYHPQSNGQVERFNQTLL 385 >SB_56290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 31.9 bits (69), Expect = 0.49 Identities = 17/62 (27%), Positives = 30/62 (48%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 + + GI H S+PY P+ NG E+ +R L + A++ I W +A+ + Sbjct: 253 LKSKGIAHSRSSPYYPKANGQVERFHRYLGYGLRA----AEIDGISWMDALPGILQVYRA 308 Query: 204 SP 209 +P Sbjct: 309 TP 310 >SB_52339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 20 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 62 >SB_42915| Best HMM Match : rve (HMM E-Value=1.4e-38) Length = 610 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 367 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 409 >SB_39760| Best HMM Match : rve (HMM E-Value=1.1e-29) Length = 634 Score = 31.9 bits (69), Expect = 0.49 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P NG +E+ R+ + K M Sbjct: 358 NGIKHITSAPKHPASNGFAERYVRTFKKTMKKM 390 >SB_39602| Best HMM Match : rve (HMM E-Value=1.4e-38) Length = 523 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 383 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 425 >SB_31504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 524 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 566 >SB_30319| Best HMM Match : rve (HMM E-Value=1.2e-37) Length = 255 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 131 GIEHKKEIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 173 >SB_19168| Best HMM Match : rve (HMM E-Value=3.9e-38) Length = 586 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 207 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 249 >SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18) Length = 1138 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 895 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 937 >SB_14976| Best HMM Match : rve (HMM E-Value=1.3e-38) Length = 1172 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 1020 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 1062 >SB_10281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 257 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 299 >SB_9047| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19) Length = 1116 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 873 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 915 >SB_8981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1726 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 107 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 149 >SB_4255| Best HMM Match : rve (HMM E-Value=1.4e-38) Length = 899 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 656 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 698 >SB_3392| Best HMM Match : rve (HMM E-Value=1.4e-38) Length = 374 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 GI+H+ PY P+ NG E+ NR++++ ++ A LQ W +A+ Sbjct: 131 GIEHKKGIPYWPQSNGEVERCNRTILK----VIRIANLQGNDWKKAL 173 >SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2353 Score = 31.5 bits (68), Expect = 0.65 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVE 116 GI+H+ PY P+ NG E+ NR++++ Sbjct: 2327 GIEHKKGIPYWPQSNGEVERCNRTILK 2353 >SB_39756| Best HMM Match : Ribosomal_S25 (HMM E-Value=2.6) Length = 190 Score = 31.5 bits (68), Expect = 0.65 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 84 LSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTPYE 242 L E+ NR+ + + EA + W E+ + A+Y +N + R + E TPYE Sbjct: 2 LVERSNRTFKDLRAILQSEAHKEMKRWCESTSQASYTMNITHHRAINE-TPYE 53 >SB_37558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 31.5 bits (68), Expect = 0.65 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 4/39 (10%) Frame = +3 Query: 18 RQIHAS-GIKHQTSAPYTPEQNGLSE---KMNRSLVERA 122 RQ A G KH TS+PY P+ NG +E K+ S++++A Sbjct: 107 RQFSADYGFKHTTSSPYHPKSNGRAEAAVKVATSMLKKA 145 >SB_16047| Best HMM Match : rve (HMM E-Value=2e-12) Length = 233 Score = 31.5 bits (68), Expect = 0.65 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVE 116 GI+H+ PY P+ NG E+ NR++++ Sbjct: 207 GIEHKKGIPYWPQSNGEVERCNRTILK 233 >SB_13442| Best HMM Match : rve (HMM E-Value=2.3e-13) Length = 271 Score = 31.5 bits (68), Expect = 0.65 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVE 116 GI+H+ PY P+ NG E+ NR++++ Sbjct: 245 GIEHKKGIPYWPQSNGEVERCNRTILK 271 >SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3297 Score = 31.5 bits (68), Expect = 0.65 Identities = 17/62 (27%), Positives = 31/62 (50%) Frame = +3 Query: 57 APYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTP 236 +P TP GL E+ N + E + +L + W +A A+Y +N + R + + +P Sbjct: 977 SPRTPTTQGLVERSNCTWKEDMRAILISKQKSVGEWCKATMEASYTMNITYHRAI-KCSP 1035 Query: 237 YE 242 Y+ Sbjct: 1036 YQ 1037 >SB_51361| Best HMM Match : rve (HMM E-Value=6.4e-14) Length = 162 Score = 31.5 bits (68), Expect = 0.65 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 4/39 (10%) Frame = +3 Query: 18 RQIHAS-GIKHQTSAPYTPEQNGLSE---KMNRSLVERA 122 RQ A G KH TS+PY P+ NG +E K+ S++++A Sbjct: 107 RQFSADYGFKHTTSSPYHPKSNGRAEAAVKVATSMLKKA 145 >SB_10363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 31.5 bits (68), Expect = 0.65 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVE 116 GI+H+ PY P+ NG E+ NR++++ Sbjct: 656 GIEHKKGIPYWPQSNGEVERCNRTILK 682 >SB_2192| Best HMM Match : rve (HMM E-Value=4e-23) Length = 491 Score = 31.5 bits (68), Expect = 0.65 Identities = 17/62 (27%), Positives = 31/62 (50%) Frame = +3 Query: 57 APYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINRSPSRVLAEVTP 236 +P TP GL E+ N + E + +L + W +A A+Y +N + R + + +P Sbjct: 247 SPRTPTTQGLVERSNCTWKEDMRAILISKQKSVGEWCKATMEASYTMNITYHRAI-KCSP 305 Query: 237 YE 242 Y+ Sbjct: 306 YQ 307 >SB_58283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 31.1 bits (67), Expect = 0.86 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAK 146 + ++GIK ++ P P+ NGL E+ NR++ + K E K Sbjct: 236 LKSNGIKWVSTTPLWPQANGLVERTNRTIEKILKIATVEKK 276 >SB_54349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 971 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAK-LQK 155 + ++GIK ++ P P+ NGL E+ NR + + K E K LQK Sbjct: 742 LKSNGIKWVSTTPLWPQANGLIERTNRIIEKILKIATVEKKDLQK 786 >SB_36817| Best HMM Match : rve (HMM E-Value=6.2e-36) Length = 924 Score = 31.1 bits (67), Expect = 0.86 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 + A GI + PY P NG E+ N + + + L + L W + + A + I R Sbjct: 709 LSARGIASSRTTPYHPIGNGQVERYNGIIWKAVQLALKSSNLPVTKWEQMLPDALHSI-R 767 Query: 204 SPSRVLAEVTPYEKW 248 S TP+E++ Sbjct: 768 SLLCTSTNTTPHERF 782 >SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1803 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 18 RQIHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKL 149 R+ ++H+ +A Y QNG +K + L+E KC L + L Sbjct: 510 RRFDEINVQHEAAADYVNLQNGEPDKRCKKLMEELKCHLIPSCL 553 >SB_21678| Best HMM Match : rve (HMM E-Value=2e-36) Length = 350 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/56 (33%), Positives = 29/56 (51%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 +GI + PY P+ N +E+ NR+L+ L E K K W E V++ A+ N Sbjct: 119 AGITKSRTTPYHPQGNAQTERFNRTLLNMLG-TLDEDK--KSSWPEYVSSMAHAYN 171 >SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2028 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 +GI + PY P+ N +E+ NR+L++ + + +K W E V++ A+ N Sbjct: 1114 AGITKSRTTPYHPQGNAQTERFNRTLLDMLGTLDGD---KKSSWPEYVSSMAHAYN 1166 >SB_25556| Best HMM Match : rve (HMM E-Value=2.8e-17) Length = 735 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +3 Query: 39 IKHQTSAPYTPEQNGLSEKMNRSLVE 116 IKH+ S P++P QNG E R+L E Sbjct: 124 IKHELSRPHSPHQNGNDEMQWRTLFE 149 >SB_23039| Best HMM Match : rve (HMM E-Value=2.8e-20) Length = 984 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAK-LQK 155 + ++GIK ++ P P+ NGL E+ N ++ + K E K LQK Sbjct: 885 LRSNGIKWVSTTPLWPQANGLVERTNETIEKVLKIATVEKKDLQK 929 >SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 406 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVE 116 G+K + PY + NGL E++NR+L E Sbjct: 154 GLKKSKTTPYHTQGNGLCERLNRTLHE 180 >SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 777 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCM 131 +GIKH TSAP P N +E+ R+ E K M Sbjct: 221 NGIKHITSAPKHPASNEFAERYVRTFKETMKKM 253 >SB_18798| Best HMM Match : rve (HMM E-Value=2.2e-20) Length = 151 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVE 116 GI HQ PY P+ NG E NR++++ Sbjct: 82 GIDHQKRIPYWPQSNGEVEGCNRTIMK 108 >SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 748 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 57 APYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 +P TP GL E+ NR+ E + +L + W +A A+Y +N Sbjct: 540 SPRTPTTQGLVERSNRTWKEDMRAILISKQKSVGEWFKATMEASYNMN 587 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEK 95 + +KH T+APY P+ NG +E+ Sbjct: 764 NSVKHTTTAPYRPKSNGQAER 784 >SB_40189| Best HMM Match : rve (HMM E-Value=1.4e-08) Length = 326 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 4/39 (10%) Frame = +3 Query: 18 RQIHAS-GIKHQTSAPYTPEQNGLSE---KMNRSLVERA 122 RQ A G KH S+PY P+ NG +E K+ +S++++A Sbjct: 89 RQFSADYGFKHTASSPYHPKGNGRAEAAVKVAKSMLKKA 127 >SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1356 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 G+K + PY P+ NG ++ NR+L + + + + K + W E + Y N Sbjct: 1078 GVKKSRTTPYHPQGNGQCDRFNRTLHDLLRTLPADKKRR---WPEHLKELCYGYN 1129 >SB_8339| Best HMM Match : rve (HMM E-Value=5.4e-31) Length = 351 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ERA KLQ+ + V T R Sbjct: 114 NGIQHIPVAPLHPSSNGQAERTVQTVKEGIERASGRDLTTKLQRFLFQYRV-TPHTTTGR 172 Query: 204 SPSRVL 221 SP+ +L Sbjct: 173 SPAELL 178 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAK 125 G+K ++ P P+ NGL E+ NRS+++ K Sbjct: 1987 GVKWLSTTPLWPQANGLVERTNRSILKVLK 2016 >SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1089 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ERA KLQ+ + V T R Sbjct: 863 NGIQHIPVAPVHPSSNGQAERTVQTVKEGIERASGRDLTTKLQRFLFQYRV-TPHTTTGR 921 Query: 204 SPSRVL 221 SP+ +L Sbjct: 922 SPAELL 927 >SB_31709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 4/39 (10%) Frame = +3 Query: 18 RQIHAS-GIKHQTSAPYTPEQNGLSE---KMNRSLVERA 122 RQ A G KH S+PY P+ NG +E K+ +S++++A Sbjct: 239 RQFSADYGFKHTASSPYHPKGNGRAEAAVKVAKSMLKKA 277 >SB_25425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+A Y P+ NG +E+ Sbjct: 520 EAFDKFMKQNGVKHNTTALYHPKSNGQAER 549 >SB_59388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +3 Query: 66 TPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 TP GL E+ NR+ E + +L + W +A A+Y +N Sbjct: 304 TPTTQGLVERSNRTWKEDMRAILISKQKSVGEWCKATMEASYTMN 348 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ N +E+ Sbjct: 1530 EAFDKFMKQNGVKHTTTAPYHPKSNVQAER 1559 >SB_17283| Best HMM Match : rve (HMM E-Value=2.5e-35) Length = 316 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 15 VRQIHASGIKHQTSAPYTPEQNGLSEKMNRSLVE 116 V + +GIKH PY P+ NG +E+ R + E Sbjct: 71 VEFMRKNGIKHTLVPPYHPQSNGAAERSVRVVKE 104 >SB_13623| Best HMM Match : rve (HMM E-Value=0.00044) Length = 203 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 6 EACVRQIHASGIKHQTSAPYTPEQNGLSEK 95 EA + + +G+KH T+APY P+ N +E+ Sbjct: 37 EAFDKFMKQNGVKHTTTAPYHPKSNVQAER 66 >SB_51339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 406 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAK-LQK 155 + ++GIK ++ P P+ +GL ++ NR++ + K E K LQK Sbjct: 225 LKSNGIKWVSTTPLWPQASGLVDRTNRTIEKILKIATVEKKDLQK 269 >SB_46540| Best HMM Match : RVT_1 (HMM E-Value=4.8e-27) Length = 751 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +3 Query: 39 IKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIIN 200 ++ + PY P+ NG +E+ NR+L+ M + K W + VA + N Sbjct: 504 VEKSRTTPYHPQGNGQTERFNRTLLNMLGTMEVDKKND---WPDYVAGLVHAYN 554 >SB_30755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 906 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 138 EAKLQKIYWAEAVATAAYIINRSPSRVLAEVTP 236 +++LQ I WA+AV Y N PSR A P Sbjct: 606 DSRLQLIQWADAVGLEGYESNALPSREEAVAPP 638 >SB_46587| Best HMM Match : rve (HMM E-Value=1e-04) Length = 436 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 4/39 (10%) Frame = +3 Query: 18 RQIHAS-GIKHQTSAPYTPEQNGLSE---KMNRSLVERA 122 RQ A G KH TS+PY + NG +E K+ +S++++A Sbjct: 199 RQFSADYGFKHTTSSPYHQKGNGRAEAAVKVAKSMLKKA 237 >SB_44798| Best HMM Match : rve (HMM E-Value=3.4e-33) Length = 243 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEK 95 +G+K T+APY P+ NG +E+ Sbjct: 126 NGVKDTTTAPYHPKSNGQAER 146 >SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1436 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 21 QIHA-SGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAV 176 Q+H SG+ + PY NG E+MNR+ + K + + +K W E++ Sbjct: 971 QLHKISGVSKSRTTPYHQMGNGKVERMNRTFLSMLKTL---PETRKSKWDESL 1020 >SB_14677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/75 (25%), Positives = 32/75 (42%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 + A GI + PY P N E+ N + + + L + L W + + A + I R Sbjct: 113 LSARGIASSRTTPYHPIGNSQVERYNGIIWKAVQLALKSSNLPVTKWEQMLPDALHSI-R 171 Query: 204 SPSRVLAEVTPYEKW 248 S TP+E++ Sbjct: 172 SLLCTSTNTTPHERF 186 >SB_44253| Best HMM Match : rve (HMM E-Value=8.4e-10) Length = 589 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAK 146 G KH TS+P P+ NG E+ V+ K L EAK Sbjct: 470 GFKHITSSPTYPKSNGFIERQ----VKYVKSALIEAK 502 >SB_37291| Best HMM Match : rve (HMM E-Value=4.8e-19) Length = 214 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRS 107 +GI+H T Y P NGL+E++ +S Sbjct: 156 NGIRHVTGRAYNPVTNGLAERLVQS 180 >SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) Length = 711 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/75 (25%), Positives = 32/75 (42%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 + A GI + PY P N E+ N + + + L + L W + + A + I R Sbjct: 20 LSARGIASSRTTPYHPIGNSQVERYNGIIWKAVQLALKSSNLPVTKWEQMLPDALHSI-R 78 Query: 204 SPSRVLAEVTPYEKW 248 S TP+E++ Sbjct: 79 SLLCTSTNTTPHERF 93 >SB_25012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -3 Query: 661 SFLVHHTSCQKKYQYLKVLM*HFQCLFESYHQPASKIFHCFFV 533 +F++ T LK+ HF+ +F+S+ K +H F V Sbjct: 302 TFMIEDTPVHVHKSMLKIRCEHFRSMFQSHWNEDEKDYHVFLV 344 >SB_55617| Best HMM Match : GPW_gp25 (HMM E-Value=9.5) Length = 173 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/75 (24%), Positives = 30/75 (40%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 ++ G+ + Y PE NG E+ N + + L L W E + + I R Sbjct: 8 LNEKGVATSRTTAYNPEGNGQVERYNEVVWKAISASLKSKNLPVKRWQEVLPDVLHSI-R 66 Query: 204 SPSRVLAEVTPYEKW 248 S TP+E++ Sbjct: 67 SLLCTATNETPHERF 81 >SB_59190| Best HMM Match : rve (HMM E-Value=6e-18) Length = 660 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 606 GFRHTTSSPEYPQSNGAAEK 625 >SB_57305| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 351 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 122 GFRHTTSSPEYPQSNGAAEK 141 >SB_43123| Best HMM Match : rve (HMM E-Value=6e-18) Length = 400 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 346 GFRHTTSSPEYPQSNGAAEK 365 >SB_39709| Best HMM Match : rve (HMM E-Value=6e-18) Length = 383 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 329 GFRHTTSSPEYPQSNGAAEK 348 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ER KLQ+ + V T R Sbjct: 1592 NGIQHIPVAPLHPSSNGQAERTVQTVKEGIERTPGRDLTTKLQRFLFQYRV-TPHTTTGR 1650 Query: 204 SPSRVL 221 SP+ +L Sbjct: 1651 SPAELL 1656 >SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) Length = 1082 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEK 95 +H +GIKH PY P+ N +E+ Sbjct: 838 MHKNGIKHTLVPPYHPQSNEAAER 861 >SB_30312| Best HMM Match : rve (HMM E-Value=5.6e-15) Length = 385 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ER KLQ+ + V T R Sbjct: 154 NGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPGRDLTTKLQRFLFQYRV-TPHTTTGR 212 Query: 204 SPSRVL 221 SP+ +L Sbjct: 213 SPAELL 218 >SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1022 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/75 (24%), Positives = 30/75 (40%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 ++ G+ + Y PE NG E+ N + + L L W E + + I R Sbjct: 683 LNEKGVATSRTTAYNPEGNGQVERYNGVVWKAISASLKSKNLPAKRWQEVLPDVLHSI-R 741 Query: 204 SPSRVLAEVTPYEKW 248 S TP+E++ Sbjct: 742 SLLCTATNETPHERF 756 >SB_25327| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 319 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 140 GFRHTTSSPEYPQSNGAAEK 159 >SB_19527| Best HMM Match : rve (HMM E-Value=1e-20) Length = 311 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 200 GFRHTTSSPEYPQSNGAAEK 219 >SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 596 GFRHTTSSPEYPQSNGAAEK 615 >SB_12365| Best HMM Match : rve (HMM E-Value=0.00031) Length = 290 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 61 GFRHTTSSPEYPQSNGAAEK 80 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ER KLQ+ + V T R Sbjct: 903 NGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPGRDLTTKLQRFLFQYRV-TPHTTTGR 961 Query: 204 SPSRVL 221 SP+ +L Sbjct: 962 SPAELL 967 >SB_5129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 13 GFRHTTSSPEYPQSNGAAEK 32 >SB_4292| Best HMM Match : rve (HMM E-Value=0.0023) Length = 227 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 61 GFRHTTSSPEYPQSNGAAEK 80 >SB_55004| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 682 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ER KLQ+ + V T R Sbjct: 445 NGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPGRDLTTKLQRFLFQYRV-TPHTTTGR 503 Query: 204 SPSRVL 221 SP+ +L Sbjct: 504 SPAELL 509 >SB_51753| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 378 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ER KLQ+ + V T R Sbjct: 269 NGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPGRDLTTKLQRFLFQYRV-TPHTTTGR 327 Query: 204 SPSRVL 221 SP+ +L Sbjct: 328 SPAELL 333 >SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 800 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 637 GFRHTTSSPEYPQSNGAAEK 656 >SB_46176| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 378 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ER KLQ+ + V T R Sbjct: 269 NGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPGRDLTTKLQRFLFQYRV-TPHTTTGR 327 Query: 204 SPSRVL 221 SP+ +L Sbjct: 328 SPAELL 333 >SB_46067| Best HMM Match : rve (HMM E-Value=6e-18) Length = 254 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 200 GFRHTTSSPEYPQSNGAAEK 219 >SB_45972| Best HMM Match : Ribosomal_L21e (HMM E-Value=9) Length = 246 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ER KLQ+ + V T R Sbjct: 9 NGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPGRDLTTKLQRFLFQYRV-TPHTTTGR 67 Query: 204 SPSRVL 221 SP+ +L Sbjct: 68 SPAELL 73 >SB_34611| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 875 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 646 GFRHTTSSPEYPQSNGAAEK 665 >SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17) Length = 890 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 694 GFRHTTSSPEYPQSNGAAEK 713 >SB_25480| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 373 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 144 GFRHTTSSPEYPQSNGAAEK 163 >SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) Length = 1544 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 33 SGIKHQTSAPYTPEQNGLSEKMNRSL---VERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 +GI+H AP P NG +E+ +++ +ER KLQ+ + V T R Sbjct: 1060 NGIQHIPVAPLHPSSNGQAERTVQTVKEGIERTPGRDLTTKLQRFLFQYRV-TPHTTTGR 1118 Query: 204 SPSRVL 221 SP+ +L Sbjct: 1119 SPAELL 1124 >SB_16064| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 371 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 36 GIKHQTSAPYTPEQNGLSEK 95 G +H TS+P P+ NG +EK Sbjct: 275 GFRHTTSSPEYPQSNGAAEK 294 >SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1677 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/75 (24%), Positives = 30/75 (40%) Frame = +3 Query: 24 IHASGIKHQTSAPYTPEQNGLSEKMNRSLVERAKCMLFEAKLQKIYWAEAVATAAYIINR 203 ++ G+ + Y PE NG E+ N + + L L W E + + I R Sbjct: 959 LNEKGVATSRTTAYNPEGNGQVERYNGVVWKAISASLKSKNLPAKRWQEVLPDVLHSI-R 1017 Query: 204 SPSRVLAEVTPYEKW 248 S TP+E++ Sbjct: 1018 SLLCTATNETPHERF 1032 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,592,850 Number of Sequences: 59808 Number of extensions: 406647 Number of successful extensions: 1190 Number of sequences better than 10.0: 189 Number of HSP's better than 10.0 without gapping: 1123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1189 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -