BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060223.seq (631 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 24 1.1 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 4.3 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 5.7 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 5.7 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 5.7 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 5.7 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.9 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 9.9 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 24.2 bits (50), Expect = 1.1 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = +1 Query: 91 ENHNMSKKRGNKKNQDLDDDFDEKPSVMNEKTE 189 +N N +K+ GN++N + +D + + N+ + Sbjct: 448 DNQNANKQNGNRQNDNRQNDNKQNGNRQNDNKQ 480 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 345 KKGADRSDDEEDDNKSI 395 K+ D DD+E DN++I Sbjct: 82 KEETDDKDDDESDNENI 98 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 253 RYRYNLQFYSSSCLFLYF 200 +Y YN Y+++C LY+ Sbjct: 97 KYNYNNNNYNNNCKKLYY 114 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 253 RYRYNLQFYSSSCLFLYF 200 +Y YN Y+++C LY+ Sbjct: 97 KYNYNNNNYNNNCKKLYY 114 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 253 RYRYNLQFYSSSCLFLYF 200 +Y YN Y+++C LY+ Sbjct: 97 KYNYNNNNYNNNCKKLYY 114 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 253 RYRYNLQFYSSSCLFLYF 200 +Y YN Y+++C LY+ Sbjct: 97 KYNYNNNNYNNNCKKLYY 114 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 530 AKPVGKKKTXN*RKIIEAQSSDEDDDP 610 AK KKK + +K+I ++S + + P Sbjct: 334 AKKKSKKKESDDKKVISSKSGSKANSP 360 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 136 LDFFCFLSFS 107 LDFF FLSF+ Sbjct: 276 LDFFVFLSFA 285 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -1 Query: 121 FLSFSTYYGFLF*QKYCLXKLN 56 F+ TY FL YC +LN Sbjct: 100 FMGMRTYEDFLSVAVYCRDRLN 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,475 Number of Sequences: 438 Number of extensions: 1870 Number of successful extensions: 21 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -