BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060221.seq (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0145 - 13116302-13116958,13117365-13117430,13117786-131180... 28 7.4 04_03_0651 - 18417856-18418109,18418203-18418314,18418579-184186... 27 9.8 02_01_0594 - 4413016-4413091,4413201-4413268,4413387-4413482,441... 27 9.8 >01_03_0145 - 13116302-13116958,13117365-13117430,13117786-13118065, 13118283-13119028 Length = 582 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 499 RSXHSXPIRTKXSSEWVFDGVKAPNIGPGP 410 RS HS P S +W+ D K P + P P Sbjct: 420 RSVHSYPCWDLISIKWIIDIPKLPQLCPSP 449 >04_03_0651 - 18417856-18418109,18418203-18418314,18418579-18418631, 18418910-18418988,18419077-18419213,18419295-18419405, 18419509-18419561,18420265-18420326 Length = 286 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 400 CLDQDQDQCLGPLPHQKPIR 459 CL+QD D LG L +Q P+R Sbjct: 47 CLNQDDDDLLGLLGNQTPLR 66 >02_01_0594 - 4413016-4413091,4413201-4413268,4413387-4413482, 4413600-4413689,4413760-4413886,4413983-4414038, 4414203-4414379,4414464-4415057 Length = 427 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = -3 Query: 419 SWSWSKHEVRRGSWWMIKRSRTLVVRPISPIVISKCIAVXVXPYLSS 279 +W S +E S W +R L+ RP+ P+ + +C + L++ Sbjct: 137 AWDLSDNEAAPASSWATLPNRALLCRPL-PLDVGRCTCIIAKETLAA 182 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,749,182 Number of Sequences: 37544 Number of extensions: 292489 Number of successful extensions: 657 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -