BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060221.seq (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68337-10|CAA92753.1| 647|Caenorhabditis elegans Hypothetical p... 27 8.7 AL032641-8|CAA21650.1| 647|Caenorhabditis elegans Hypothetical ... 27 8.7 >Z68337-10|CAA92753.1| 647|Caenorhabditis elegans Hypothetical protein M7.5 protein. Length = 647 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 340 GLTTKVLDRLIIHQXPLRTSCLDQDQDQCLGPLPHQ 447 G+ ++L ++ + PL+T D LG PHQ Sbjct: 536 GIAVELLSSVLQYPDPLKTPASHDDNTTVLGAAPHQ 571 >AL032641-8|CAA21650.1| 647|Caenorhabditis elegans Hypothetical protein M7.5 protein. Length = 647 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 340 GLTTKVLDRLIIHQXPLRTSCLDQDQDQCLGPLPHQ 447 G+ ++L ++ + PL+T D LG PHQ Sbjct: 536 GIAVELLSSVLQYPDPLKTPASHDDNTTVLGAAPHQ 571 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,739,143 Number of Sequences: 27780 Number of extensions: 257336 Number of successful extensions: 510 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -