BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060218.seq (670 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 27 0.53 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 27 0.53 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 27 0.53 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 26 1.2 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 27.1 bits (57), Expect = 0.53 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -2 Query: 333 YLNLFKYLRSFVFINY*DTIVLNNCN*HLARLTIRTYSLIRLIFNMLTETYKL---TMYA 163 YL+ F+Y + IN T+V A +T +I FN E + L ++A Sbjct: 615 YLSWFRYANEALLINQWSTVVDGEIACTRANVTCPRSEIILETFNFRVEDFALDIACLFA 674 Query: 162 LIDLF 148 LI LF Sbjct: 675 LIVLF 679 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 27.1 bits (57), Expect = 0.53 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -2 Query: 333 YLNLFKYLRSFVFINY*DTIVLNNCN*HLARLTIRTYSLIRLIFNMLTETYKL---TMYA 163 YL+ F+Y + IN T+V A +T +I FN E + L ++A Sbjct: 615 YLSWFRYANEALLINQWSTVVDGEIACTRANVTCPRSEIILETFNFRVEDFALDIACLFA 674 Query: 162 LIDLF 148 LI LF Sbjct: 675 LIVLF 679 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 27.1 bits (57), Expect = 0.53 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -2 Query: 333 YLNLFKYLRSFVFINY*DTIVLNNCN*HLARLTIRTYSLIRLIFNMLTETYKL---TMYA 163 YL+ F+Y + IN T+V A +T +I FN E + L ++A Sbjct: 593 YLSWFRYANEALLINQWSTVVDGEIACTRANVTCPRSEIILETFNFRVEDFALDIACLFA 652 Query: 162 LIDLF 148 LI LF Sbjct: 653 LIVLF 657 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 456 ENALTFKIIMERYSQAYIISYVIYEAISAFLCEYV 352 E +TF II+ R + Y ++ ++ + +FLC V Sbjct: 219 ETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLV 253 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,231 Number of Sequences: 2352 Number of extensions: 14778 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -