BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060218.seq (670 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 26 0.37 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 2.0 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 6.1 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 6.1 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 25.8 bits (54), Expect = 0.37 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 456 ENALTFKIIMERYSQAYIISYVIYEAISAFLCEYV 352 E +TF II+ R + Y ++ ++ + +FLC V Sbjct: 220 ETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLV 254 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 167 MHLSIYLL-NGLYNLPDFKN*FYQQYVVSSCVSMLWSVIPNQLAR 36 M ++Y+L NG ++LP F FY V+ S +++++ + R Sbjct: 240 MPFAVYVLVNGSWSLPGFVCDFYIAMDVTCSTSSIFNLVAISIDR 284 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 6.1 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -2 Query: 549 TSSFIRQ--LPKEHFNHISXHTTATVCIYNTE*ENALTFKIIMERY 418 T + IR+ +PKE S +T V I N + +A+ + + RY Sbjct: 288 TDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDCGSAIAYVSDVFRY 333 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -3 Query: 605 INNLYNSQYLAHVHA*SNIHHLSYVNFQKNTLIT 504 INN N+ L HV A + H + N +I+ Sbjct: 340 INNSQNALVLRHVQAEAEKHAAMLYQYNFNIIIS 373 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,917 Number of Sequences: 438 Number of extensions: 3493 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -