BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060218.seq (670 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g35600.1 68418.m04238 histone deacetylase, putative (HDA7) si... 29 2.1 At2g15080.2 68415.m01719 disease resistance family protein conta... 27 8.5 At2g15080.1 68415.m01718 disease resistance family protein conta... 27 8.5 >At5g35600.1 68418.m04238 histone deacetylase, putative (HDA7) similar to SP|O22446 Histone deacetylase (HD) {Arabidopsis thaliana}; contains Pfam profile PF00850: Histone deacetylase family Length = 409 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = -3 Query: 641 HTFLLSYXLTXHINNLYNSQYLAHVHA*SNIHHLSYVNFQKNTLIT*VXIPQP 483 H +LSY L H+ N LA H L Y+NF K+ V P P Sbjct: 40 HNLILSYNLHRHME--INHPDLADASDFEKFHSLEYINFLKSVTPETVTDPHP 90 >At2g15080.2 68415.m01719 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 983 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -1 Query: 466 YRIGKCSNFQDYHGKI*PGIHN*LCDI 386 ++ KCS+F+D HG P + +CDI Sbjct: 888 FQTQKCSSFEDNHGLYGPSLEK-ICDI 913 >At2g15080.1 68415.m01718 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 983 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -1 Query: 466 YRIGKCSNFQDYHGKI*PGIHN*LCDI 386 ++ KCS+F+D HG P + +CDI Sbjct: 888 FQTQKCSSFEDNHGLYGPSLEK-ICDI 913 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,462,963 Number of Sequences: 28952 Number of extensions: 253253 Number of successful extensions: 373 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -