BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060217.seq (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 2.0 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.1 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.1 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 317 NVPCGTSGGVLIYFERIEVVNNAGP 391 +VPCGTSG L + ++ V P Sbjct: 225 SVPCGTSGNPLEWTGQVTVRKKRKP 249 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 197 CLLSGWSFITSYKSSWFSHVIP 262 CL S + +T+Y +S F +V P Sbjct: 678 CLASNSASVTTYTTSLFINVPP 699 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 6.1 Identities = 11/48 (22%), Positives = 20/48 (41%) Frame = +1 Query: 157 FIFPFIK*KKDMLVFIIGVELYYQLQVKLVFTCDTTSNXIXSHSXNFT 300 FI+ F+ K + F + ++Y + + F D S H+ T Sbjct: 54 FIYAFVAPVKCLAFFCTALVIFYCQEGSVDFLFDNFSAAFQDHNIEIT 101 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.1 Identities = 11/48 (22%), Positives = 20/48 (41%) Frame = +1 Query: 157 FIFPFIK*KKDMLVFIIGVELYYQLQVKLVFTCDTTSNXIXSHSXNFT 300 FI+ F+ K + F + ++Y + + F D S H+ T Sbjct: 287 FIYAFVAPVKCLAFFCTALVIFYCQEGSVDFLFDNFSAAFQDHNIEIT 334 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.1 Identities = 11/48 (22%), Positives = 20/48 (41%) Frame = +1 Query: 157 FIFPFIK*KKDMLVFIIGVELYYQLQVKLVFTCDTTSNXIXSHSXNFT 300 FI+ F+ K + F + ++Y + + F D S H+ T Sbjct: 287 FIYAFVAPVKCLAFFCTALVIFYCQEGSVDFLFDNFSAAFQDHNIEIT 334 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,382 Number of Sequences: 336 Number of extensions: 2628 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -