BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060217.seq (605 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 23 2.3 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 7.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.1 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 9.4 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/45 (26%), Positives = 18/45 (40%) Frame = -2 Query: 409 ISSTLCGSSVIDYLDSFKINQHPTTCATRHIFNFISL*SCXNGXV 275 I TL V+D+ F IN TC + + + NG + Sbjct: 96 IDVTLQNDEVLDWKKIFDINLLGLTCMIQEVLKLMKKKGINNGII 140 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 382 VIDYLDSFKINQHP 341 +IDY S+K++Q P Sbjct: 425 IIDYYHSYKMHQKP 438 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 382 VIDYLDSFKINQHP 341 +IDY S+K++Q P Sbjct: 425 IIDYYHSYKMHQKP 438 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = -1 Query: 218 SSTPIINTNMSFFYFMKGKMNRDPYSQNHNGQNRRL 111 S+ I N N + + N + Y+ N+N ++L Sbjct: 319 SNKTIHNNNNYKYNYNNNNYNNNNYNNNYNNNCKKL 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,714 Number of Sequences: 438 Number of extensions: 2932 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -