BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060216.seq (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 23 2.3 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 6.9 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 6.9 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 6.9 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 21 9.1 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 9.1 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 23.0 bits (47), Expect = 2.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 345 EELXGRNPHRLVWQSKVGPLPWLQPYTDDAIKLYAKQGVKH 467 E L GR P + G LP P T + I A++ +KH Sbjct: 344 EILYGRTPPNPLDAVTSGLLPVRPPLTREEIHEKARENLKH 384 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 598 CTPRSSRPLGRTSVGGPHL 654 C+P S RTS G HL Sbjct: 150 CSPGSGHQDSRTSPSGQHL 168 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 598 CTPRSSRPLGRTSVGGPHL 654 C+P S RTS G HL Sbjct: 150 CSPGSGHQDSRTSPSGQHL 168 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 598 CTPRSSRPLGRTSVGGPHL 654 C+P S RTS G HL Sbjct: 150 CSPGSGHQDSRTSPSGQHL 168 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = +2 Query: 359 PESAPARLAVQGGPPALAPALHRRRDQVVREARCQAPDPGAS 484 P S+PA A P ++A Q+V AP A+ Sbjct: 154 PRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSAN 195 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = +2 Query: 359 PESAPARLAVQGGPPALAPALHRRRDQVVREARCQAPDPGAS 484 P S+PA A P ++A Q+V AP A+ Sbjct: 145 PRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSAN 186 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,705 Number of Sequences: 336 Number of extensions: 2435 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -