BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060215.seq (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g05523.1 68417.m00840 hypothetical protein 28 6.2 At2g34710.1 68415.m04263 homeobox-leucine zipper transcription f... 28 6.2 >At4g05523.1 68417.m00840 hypothetical protein Length = 221 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +3 Query: 339 EIERCVTTCSLKTNYRRTRRETKQ**PISCSRNLQTVIE--INIINR 473 EIER ++ +L YR RRE ++ + R + +E +N++ R Sbjct: 146 EIERALSAIALVEKYRENRREVERSLDLQYKREVSEALETHMNVVKR 192 >At2g34710.1 68415.m04263 homeobox-leucine zipper transcription factor (HB-14) identical to homeodomain transcription factor (ATHB-14)GP:3132474 GB:Y11122 [Arabidopsis thaliana]; Length = 852 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 505 LPAYICLCTEDRLIMLISITVWRFREHDIGYYC 407 LPA +C + R++ TVW+ E D +C Sbjct: 809 LPAGVCASSMGRMVSYEQATVWKVLEDDESNHC 841 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,012,654 Number of Sequences: 28952 Number of extensions: 278024 Number of successful extensions: 663 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 663 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -