BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060211.seq (583 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 84 7e-17 SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) 29 2.8 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 84.2 bits (199), Expect = 7e-17 Identities = 35/88 (39%), Positives = 57/88 (64%) Frame = +2 Query: 251 DMLREQLXLTLXMDLSQXLRRKVCDVVSELARNHIDDDGNNQWPEFLQFMFTCASAQDPN 430 ++++E L + + +R+K+CD VSEL+++ +DDDG N W E L+F+F C ++ Sbjct: 56 NLMKESLLKGIHEEQDSNVRKKICDAVSELSKSFLDDDGYNHWQELLKFLFECCNSPRAE 115 Query: 431 XKEAGIRMFTSVPGVFGNRQTENLDV*K 514 KE+ + +F S PGVFGN+Q L+V K Sbjct: 116 LKESALNIFCSFPGVFGNQQDHYLNVIK 143 Score = 27.9 bits (59), Expect(2) = 0.029 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 21 QFYQLLNTLLSTDNDIRSQAE 83 QF L+ L+S DND R+QAE Sbjct: 7 QFEALIGQLMSPDNDTRNQAE 27 Score = 26.6 bits (56), Expect(2) = 0.029 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +3 Query: 162 DVRQTAAVLIRRLFSA 209 +VRQ AAVL+RR+F+A Sbjct: 27 EVRQMAAVLLRRIFTA 42 >SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) Length = 354 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +2 Query: 314 KVCDVVSELARNHIDDDGNN--QWPEFLQFMFTCASAQDPN 430 ++ D+++++A +D DGN +PEFLQ M DP+ Sbjct: 249 ELMDMMNQIAFLFVDSDGNGAIDFPEFLQLMTKNLQDADPD 289 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,430,659 Number of Sequences: 59808 Number of extensions: 329304 Number of successful extensions: 732 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -