BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060211.seq (583 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 24 4.1 AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 23 7.2 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 9.5 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 9.5 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.8 bits (49), Expect = 4.1 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 89 IQQHSNRNKSSAPXEFNSKCRHCRRCASNGG 181 +Q H N + + P +C+HC C + G Sbjct: 170 LQNHVNTHTGTKPH----RCKHCDNCFTTSG 196 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 23.0 bits (47), Expect = 7.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +3 Query: 345 GIILMTMATTSGLSSYSSCLPVPVRKIQTXKKLVLECLRLYQ 470 G IL+ +A + + P P+R+ ++L+ EC LY+ Sbjct: 66 GAILIYLAEQYAPAGTTYYPPDPLRRAIVNQRLLFECGTLYK 107 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 311 RKVCDVVSELARNH 352 RK+ D V+ L RNH Sbjct: 822 RKIADAVTRLLRNH 835 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 22.6 bits (46), Expect = 9.5 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 469 WYRRKHSNTSFFXVWILRTGTG 404 W RKH FF +L TG G Sbjct: 900 WVSRKHGEVDFFLTQLL-TGHG 920 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,797 Number of Sequences: 2352 Number of extensions: 11713 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -