BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060210.seq (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|ch... 27 3.0 SPBC29A10.03c |rlf2|SPBC365.19c|chromatin remodeling complex sub... 27 3.0 SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccha... 27 3.0 SPCC1827.01c |||DUF1253 family protein|Schizosaccharomyces pombe... 26 4.0 SPBC12D12.06 |srb11||cyclin CycC|Schizosaccharomyces pombe|chr 2... 26 5.3 SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosacchar... 26 5.3 >SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 530 Score = 26.6 bits (56), Expect = 3.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 550 PLIHRTAXQERVSGCHDXVDXXNVVHIFITF 458 P ++ + Q R+ GCHD N+VH T+ Sbjct: 349 PDVYELSDQVRIPGCHDMA--ANIVHFDTTY 377 >SPBC29A10.03c |rlf2|SPBC365.19c|chromatin remodeling complex subunit Rlf2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 544 Score = 26.6 bits (56), Expect = 3.0 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 362 SSEVEPPTHQLVSTV*HSSQASEFVSQFSYDG--ALRVFNNS 243 S V P ++ + +S+A E+V + SY+G R++N S Sbjct: 30 SLSVSSPNESVIHSSHSASEADEYVCKLSYEGNRKKRIYNGS 71 >SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 578 Score = 26.6 bits (56), Expect = 3.0 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 311 NARQLKPIDELEVPLHLMDSLKKYKRP-PVQ 400 N + DEL+V L + LK YK P P+Q Sbjct: 162 NLLPILQFDELDVSAKLREGLKNYKEPTPIQ 192 >SPCC1827.01c |||DUF1253 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 652 Score = 26.2 bits (55), Expect = 4.0 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +2 Query: 320 QLKPIDELEVPLHLMDSLKKYKRPPVQLSVEEIE 421 ++K ID+L + ++DS KK K P QL+ +IE Sbjct: 160 EIKNIDDLGLKQRILDSYKKQK-PSGQLTSMQIE 192 >SPBC12D12.06 |srb11||cyclin CycC|Schizosaccharomyces pombe|chr 2|||Manual Length = 228 Score = 25.8 bits (54), Expect = 5.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 500 SCRLVQCRSHIHHVCNE 450 SC++ +C HI +CNE Sbjct: 86 SCKVEECPVHIRTICNE 102 >SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1275 Score = 25.8 bits (54), Expect = 5.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 5 TRGFLISFSRILKFKESQSRNNH 73 ++G L SFS I F +S+S N+H Sbjct: 526 SKGLLNSFSPISPFSKSKSHNHH 548 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,008,961 Number of Sequences: 5004 Number of extensions: 33170 Number of successful extensions: 78 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -