BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060207.seq (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. 27 0.67 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 27 0.67 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 0.88 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 26 1.2 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 25 2.7 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 25 2.7 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 25 2.7 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 4.7 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 4.7 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 6.2 >Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. Length = 111 Score = 26.6 bits (56), Expect = 0.67 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 310 IIAIYGLVVAVLIAGALQEPANYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAG 477 ++A L VA+++ A+ NY G+ G G + FSG + G +I + D G Sbjct: 5 LVAFATLSVALVVVVAIPANFNYGGGGGYFINGTGQSFNFSGESNGTSIPGLPDFG 60 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 26.6 bits (56), Expect = 0.67 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 310 IIAIYGLVVAVLIAGALQEPANYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAG 477 ++A L VA+++ A+ NY G+ G G + FSG + G +I + D G Sbjct: 5 LVAFATLSVALVVVVAIPANFNYGGGGGYFINGTGQSFNFSGESNGTSIPGLPDFG 60 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 26.2 bits (55), Expect = 0.88 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 288 HSCRHGGYYCHLRSGRGCPDCWCPP 362 + C++G Y ++ SG GC C C P Sbjct: 921 NECKNG--YWNIVSGNGCESCNCDP 943 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -3 Query: 137 FQPFCLLNVGVFTGPKNCDDYLHTL 63 F P+ +L +G+ G + +LHTL Sbjct: 750 FWPWSVLTIGILVGMEGLSAFLHTL 774 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 551 NTSAKNKNKNHSXEY 507 +TSA NKNKN S +Y Sbjct: 56 STSATNKNKNGSTDY 70 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 24.6 bits (51), Expect = 2.7 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = -2 Query: 351 SNQDSHDQTVDGNNTRHDDRNDRLHDQLRPHHH 253 + ++S Q+ N+ ++ + H Q +PHH+ Sbjct: 325 NKKNSQRQSAQANSGSSNNSSSHSHSQAQPHHN 357 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 551 NTSAKNKNKNHSXEY 507 +TSA NKNKN S +Y Sbjct: 56 STSATNKNKNGSTDY 70 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 4.7 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -2 Query: 468 SHDAYGETG-SQTRESY-SQTSTQVDEPFVKGVVGWLLEGTSNQDSHD 331 S D GE+ S +R S +T++QVD KG L+GT+ HD Sbjct: 1654 SSDVEGESECSSSRSSIVEETASQVDMKGRKGTNSSPLDGTTTIIIHD 1701 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 Query: 473 ASPTMPMAKPAARPENPTAKPAP 405 A M + PAA PTA P P Sbjct: 67 AEAAMDLEPPAAAQPTPTASPVP 89 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.4 bits (48), Expect = 6.2 Identities = 13/45 (28%), Positives = 17/45 (37%) Frame = -3 Query: 524 NHSXEYLRLLKQYHGTPASPTMPMAKPAARPENPTAKPAPKWMNP 390 NH EYL + P PT + +P E + P M P Sbjct: 411 NHLAEYLEAYWRATHPPVRPTPSVPRPLPSQEASPSGEQPGRMGP 455 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 728,073 Number of Sequences: 2352 Number of extensions: 15141 Number of successful extensions: 89 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -