BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060205.seq (653 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0110 - 5371536-5372882 31 0.80 02_01_0599 - 4455151-4455915,4455999-4456098,4456176-4456222,445... 29 2.4 11_03_0026 - 9057965-9058234,9059410-9059522,9059612-9059802,906... 29 3.2 10_08_0359 - 17167829-17169595,17169976-17169996 29 3.2 03_02_0982 + 12925861-12926211,12926309-12926378,12927190-129272... 28 5.6 01_06_1510 - 37859664-37861319 28 7.5 12_01_1080 + 11241590-11241625,11241723-11242018,11242113-112422... 27 9.9 08_02_0315 + 15680170-15680304,15681166-15681318 27 9.9 04_04_0271 + 24069218-24069433,24069695-24070365,24070458-24073410 27 9.9 >10_02_0110 - 5371536-5372882 Length = 448 Score = 31.1 bits (67), Expect = 0.80 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 6/68 (8%) Frame = -3 Query: 339 ITPDLVMSTVCGCKY----SG-SPCFATLSGAWSGFGRHAQTSICTCRRRGHVLPVHNLH 175 I+PD +S + +Y +G S C+ G+ G R Q S+CT R R H L VH Sbjct: 320 ISPDGKLSFIVTSRYFDGSAGVSSCYHLAFGSNGGCTRE-QVSVCTWRVRLHELRVHRSD 378 Query: 174 ILNC-WRC 154 +N W C Sbjct: 379 AMNLRWFC 386 >02_01_0599 - 4455151-4455915,4455999-4456098,4456176-4456222, 4456566-4456612,4457299-4457461,4458013-4458042 Length = 383 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/69 (24%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Frame = +2 Query: 335 VIQLIMKSKLPYAIELQEWLL--EEVIPQV--LCTGKYAPAVEMDTNDVIAKIDDLTQKL 502 V+ ++ + + +EL+E E ++ Q+ ++AP+VE +V A I+ +T+K+ Sbjct: 268 VMAILKNRREKFTLELKELQRKRENLLAQMGDPSANRHAPSVEHSLAEVAAHIEAVTEKI 327 Query: 503 TVPTQIWRK 529 + + W+K Sbjct: 328 IMEEEKWKK 336 >11_03_0026 - 9057965-9058234,9059410-9059522,9059612-9059802, 9060606-9060720,9061781-9061907,9062915-9062990, 9064247-9064365,9065430-9065593,9065666-9065779, 9065966-9066065,9066276-9066340,9068175-9068253, 9069513-9069659,9069904-9070161,9070657-9070852, 9071179-9071402,9072531-9072554 Length = 793 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 337 HARFGNEHCVWVQIQRVALLCHA 269 H FG++H + VQ+Q A++CHA Sbjct: 203 HIVFGSQHNLPVQLQAKAVICHA 225 >10_08_0359 - 17167829-17169595,17169976-17169996 Length = 595 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -3 Query: 564 HFVGKQNERSVGFRQICVGTVNFCVRSSI---LAITSFVSISTAGAYL 430 HF+ + N G + CVG V C+ + I L + + VSIS +GA + Sbjct: 284 HFIVESNGGGGGRSKRCVGLVATCMSNGITKKLRVEAKVSISASGALM 331 >03_02_0982 + 12925861-12926211,12926309-12926378,12927190-12927287, 12927467-12927615,12928083-12928198,12928521-12928617, 12929122-12929206,12929303-12929365,12929505-12929645 Length = 389 Score = 28.3 bits (60), Expect = 5.6 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = -3 Query: 600 LPSRFSVASSHNHFVGKQNERSVGFRQICVGTVNFCVRSSILAITSFVSISTAGAYLPVH 421 +PSR V SH+H G++ R +G V + A+T ++S STA A H Sbjct: 53 VPSRGHVGHSHHHHHGEEVGGEASERIFRLGLAADVVLTVGKAVTGYLSGSTAIAADAAH 112 Query: 420 S 418 S Sbjct: 113 S 113 >01_06_1510 - 37859664-37861319 Length = 551 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 301 APTHSAHYQIWRDSTDNEVQIALRHRITRMA 393 AP H H+Q++R S +ALRHR R A Sbjct: 24 APAHG-HHQVFRCSAAKPSPLALRHRAGRPA 53 >12_01_1080 + 11241590-11241625,11241723-11242018,11242113-11242269, 11242381-11242449,11242551-11243480,11243868-11243906, 11244414-11244478,11244663-11244768,11244850-11245050, 11247001-11247201,11247756-11247779,11249425-11249586, 11249676-11249915,11250267-11250479,11250618-11250968, 11251041-11251193,11251649-11251858,11252049-11252267, 11252365-11252482,11252879-11253828,11254023-11254220, 11254294-11254553,11255316-11255505,11255817-11256169, 11258278-11258386,11258466-11258615,11258748-11258844, 11259315-11259415 Length = 2065 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 165 SLKY--VNCERAIRVHVDGKYKSTFEHADQIQTMLQ 266 +LKY V+C+R R+H+D K E D + LQ Sbjct: 1514 ALKYPCVSCQRLSRLHLDYKMLKNVEVLDNLYVFLQ 1549 >08_02_0315 + 15680170-15680304,15681166-15681318 Length = 95 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 569 WLDATLKRLGKDCENARPRNGA 634 W +T +RLG C + PR GA Sbjct: 66 WTTSTSRRLGARCATSHPRQGA 87 >04_04_0271 + 24069218-24069433,24069695-24070365,24070458-24073410 Length = 1279 Score = 27.5 bits (58), Expect = 9.9 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -1 Query: 653 AMRLAKLRRFAGARFRNPCRAVSASRRATI-ISLANKMSDRLASAKSALAPSIFAS 489 A + +K+R G R C V A A++ SLA +S RLA+ A+ P I AS Sbjct: 808 ATQSSKVRSLVGDRM---CLLVQAGATASLGFSLALAVSWRLATVMMAMQPLIIAS 860 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,396,114 Number of Sequences: 37544 Number of extensions: 443677 Number of successful extensions: 1254 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1254 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -