BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060205.seq (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12932| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 31 1.1 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_6998| Best HMM Match : Ribonuclease_T2 (HMM E-Value=8) 29 3.3 SB_35244| Best HMM Match : Ldl_recept_b (HMM E-Value=3.2e-11) 29 4.4 SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9) 29 4.4 SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.4 SB_30233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_10868| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_12932| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 577 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 Query: 303 CKYSGSPCFATLSGAWSGFGRHAQ 232 CKY P + SGAW+ F RH Q Sbjct: 6 CKYVRIPGYIAASGAWTSFPRHNQ 29 >SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1338 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 312 VCGC-KYSGSPCFATLSGAWSGFGRHAQTSICTCRRRGHVL 193 VCGC G W FG A+ C R+RG VL Sbjct: 1011 VCGCCDVCAKTVTQKCGGYWGQFGTCAEGLSCVLRKRGQVL 1051 >SB_6998| Best HMM Match : Ribonuclease_T2 (HMM E-Value=8) Length = 185 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -3 Query: 612 FSQSLPSRFSVASSHNHFVGKQNERSVGFRQI--CVGTVNFCVR 487 +SQS +FSV S H+H ++R+VG R+ + FC R Sbjct: 139 YSQSHKGKFSVLSIHDH---SNSDRAVGLREFVAVLNVEEFCTR 179 >SB_35244| Best HMM Match : Ldl_recept_b (HMM E-Value=3.2e-11) Length = 534 Score = 28.7 bits (61), Expect = 4.4 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 5/64 (7%) Frame = -3 Query: 330 DLVMSTVCGCKYSGSPCFATLSGAW-----SGFGRHAQTSICTCRRRGHVLPVHNLHILN 166 +L +ST+C ++SGS LS W G A ++I CR G V NL Sbjct: 332 NLALSTICLSRHSGSVDILALSTFWLCRHFGSVGILALSTIWLCRHSG---SVDNLDQST 388 Query: 165 CWRC 154 W C Sbjct: 389 FWLC 392 >SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9) Length = 350 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +2 Query: 203 PRRRQVQIDV*ACRPNPDHA---PDSVAKQGDPLYLHP 307 P R V I + C PNPD+ PDS D Y +P Sbjct: 10 PSRSTVSISLIYCNPNPDYCYPNPDSCYPNPDSCYPNP 47 >SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1449 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +2 Query: 206 RRRQVQIDV*ACRPNPDHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSK 361 RRR +Q D+ R P+ P A G P ++ PH G L +K K Sbjct: 536 RRRHLQNDILNGRKVPEEKPSETATNGPP-FICPHANCGRSFGARHLYLKHK 586 >SB_30233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 807 Score = 28.3 bits (60), Expect = 5.8 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +2 Query: 359 KLPYAIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDLTQKLTVPTQIWRKPT 535 KLP A +QE + EE Q T +A A D I IDD++ Q W+ P+ Sbjct: 401 KLPDAKIMQEIMKEE--QQHFETRYHASARHTIQRDPIVYIDDISSYFGAKPQFWKHPS 457 >SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 27.9 bits (59), Expect = 7.6 Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 3/84 (3%) Frame = +2 Query: 251 PDHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYAIELQEWL-LEEVIP-QVLC 424 P + + K P HP TVLI +I L + + L I LQ L L+ +IP QVL Sbjct: 316 PLYKSSPLYKSSPPTSTHPSTVLIPLQVLIPLQVLTPLQVLIPLQVLLPLQVLIPLQVLI 375 Query: 425 -TGKYAPAVEMDTNDVIAKIDDLT 493 AP + T V+ + LT Sbjct: 376 PLHVLAPLQVVITLQVLTSLQVLT 399 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -3 Query: 309 CGCKYSGSPCFATLSGAWSGFGRHAQTSICTCRRRGHVLPVHNLHILNCWRCPW 148 C C Y G+ +S + R A+ +CT R +L +N + NC RC + Sbjct: 175 CVCVYGGTG----ISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTY 224 >SB_10868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 294 SGSPCFATLSGAWS 253 SGSPCF L G WS Sbjct: 26 SGSPCFLNLHGVWS 39 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,016,702 Number of Sequences: 59808 Number of extensions: 502344 Number of successful extensions: 1275 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1274 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -