BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060202.seq (656 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK093262-1|BAC04113.1| 122|Homo sapiens protein ( Homo sapiens ... 31 4.8 >AK093262-1|BAC04113.1| 122|Homo sapiens protein ( Homo sapiens cDNA FLJ35943 fis, clone TESTI2011750. ). Length = 122 Score = 30.7 bits (66), Expect = 4.8 Identities = 24/101 (23%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 648 PSVKRESLPFGPVGPIIVIARLHTFVNVSRVGALEKIFKINIFLYDL*CFFKMKGFTKM- 472 P + +S P P++ A + T V + +++IF + Y C +M G + Sbjct: 7 PGGRGKSWERTPSVPMMTNAIMETSFRVPFIYLVKQIFHFTLSRYI--CIAQMSGKYHVC 64 Query: 471 -QKSLLSNTQSWPSNVC*TACFSVASSVSSQDEPMSCFAHG 352 +K N+ WP V + C + ++ D P CF G Sbjct: 65 ERKKKDQNSHPWPGIVIQSFCPEIDIHLTCMDVPCFCFCFG 105 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,833,333 Number of Sequences: 237096 Number of extensions: 1806137 Number of successful extensions: 7336 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7336 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7366354010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -