BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060202.seq (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 1.9 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 22 5.9 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 5.9 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 7.8 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 490 ERFYKNAKIVTFQ 452 + F+KNAK VTFQ Sbjct: 122 DSFFKNAKSVTFQ 134 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 379 RAHVVFCARTVKVVSNCV 326 +AHV+ T K++ NCV Sbjct: 16 QAHVIPAELTAKLLGNCV 33 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 115 QKSPSIFT*NKNANKRFQQH 56 Q+SP + N + KR+Q+H Sbjct: 84 QQSPYLMYENPDEEKRYQEH 103 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 7.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 520 KYINFENFFKSTDPGYINKCVQAGDYYYWPNWPKGQA 630 KYINF+ FF G N V DYY++ + QA Sbjct: 8 KYINFDRFF--FIEGMTN--VLDFDYYFYDYSNRTQA 40 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,800 Number of Sequences: 438 Number of extensions: 3788 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -