BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060200.seq (651 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC215.09c |erg10||acetyl-CoA C-acetyltransferase Erg10 |Schizo... 58 1e-09 SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces ... 27 3.1 >SPBC215.09c |erg10||acetyl-CoA C-acetyltransferase Erg10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 395 Score = 58.0 bits (134), Expect = 1e-09 Identities = 25/57 (43%), Positives = 39/57 (68%) Frame = +2 Query: 317 IFIVGAKRTPFGTFGGVFRNTSATELQTIATVGALKEAGVSPAQVDSMVVGQVISSS 487 ++IV A RTP G+FGG F + AT+L +IA GAL+ + P+ VD + +G V+S++ Sbjct: 6 VYIVSAVRTPMGSFGGSFASLPATKLGSIAIKGALERVNIKPSDVDEVFMGNVVSAN 62 Score = 30.7 bits (66), Expect = 0.19 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 508 ARXAALKAGIPQEKPVLGINRLCGSGFQSIVNSAQ 612 AR AL AG+P+ +N++C SG ++ + AQ Sbjct: 68 ARQCALGAGLPRSIVCTTVNKVCASGMKATILGAQ 102 >SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 26.6 bits (56), Expect = 3.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 344 PFGTFGGVFRNTSATELQTIATVGALKEAGVSPAQVDSMV 463 P G G + + T+ Q I + L V PAQ+DS++ Sbjct: 270 PSGPMGMKTGSVNDTQSQQITLMNVLASQNVPPAQIDSIM 309 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,291,579 Number of Sequences: 5004 Number of extensions: 41898 Number of successful extensions: 126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -