BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060195.seq (667 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.11 |||nucleotide-sugar 4,6-dehydratase |Schizosaccharom... 27 1.8 SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa... 26 5.6 >SPBPB2B2.11 |||nucleotide-sugar 4,6-dehydratase |Schizosaccharomyces pombe|chr 2|||Manual Length = 365 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 468 IXNYSLIDFNLTLDYFLRRKVLLKNTIYA 382 I N SL+ F DYFL RK+ LKN Y+ Sbjct: 293 IDNLSLVKF--ICDYFLYRKLSLKNLDYS 319 >SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Par2|Schizosaccharomyces pombe|chr 1|||Manual Length = 627 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 156 KYLNQRTKLNKDNNNILVSFVQCKGYEKFRNI 61 K+LN R+ + K NN+ + F+ + EKF I Sbjct: 372 KFLNLRSYIRKSMNNVFLQFIYER--EKFHGI 401 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,109,987 Number of Sequences: 5004 Number of extensions: 35327 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -