BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060193.seq (664 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29490.1 68417.m04208 Xaa-Pro dipeptidase, putative / prolida... 75 4e-14 At1g09300.1 68414.m01041 metallopeptidase M24 family protein sim... 30 1.6 At4g35880.1 68417.m05095 aspartyl protease family protein contai... 28 4.8 At2g04280.1 68415.m00420 expressed protein 28 4.8 >At4g29490.1 68417.m04208 Xaa-Pro dipeptidase, putative / prolidase, putative / imidodipeptidase, putative similar to SP|P12955 Xaa-Pro dipeptidase (EC 3.4.13.9) (X-Pro dipeptidase) (Proline dipeptidase) (Prolidase) (Imidodipeptidase) {Homo sapiens}; contains Pfam profiles PF00557: metallopeptidase family M24, PF05195: Aminopeptidase P, N-terminal domain Length = 333 Score = 74.9 bits (176), Expect = 4e-14 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 11/123 (8%) Frame = +2 Query: 296 VPLSLFATNRRRLANKLKS---------GQIVVLQGGEDVNHYDTDVQYVFRQEAYFTWV 448 +P+ L A NR++L ++ V+LQGGE+ N Y TD +FRQE+YF ++ Sbjct: 9 IPMELHAGNRKKLLESIRRQLSSSNRSLDGFVLLQGGEEKNRYCTDHTELFRQESYFAYL 68 Query: 449 CGVREPGCYFALDVSTGKSYSLCPDFLRSMKSGWANSMPVVT--SKTYMQFDEVYYVDEI 622 GVREP Y A+D+ +GKS P L + W + ++ +TYM D V+YVDEI Sbjct: 69 FGVREPDFYGAIDIGSGKSILFIPR-LPDDYAVWLGEIKPLSHFKETYM-VDMVFYVDEI 126 Query: 623 KDV 631 V Sbjct: 127 IQV 129 >At1g09300.1 68414.m01041 metallopeptidase M24 family protein similar to SP|P15034 Xaa-Pro aminopeptidase (EC 3.4.11.9) (X-Pro aminopeptidase) (Aminopeptidase P II) (Aminoacylproline aminopeptidase) {Escherichia coli}; contains Pfam profiles PF00557: metallopeptidase family M24, PF05195: Aminopeptidase P, N-terminal domain Length = 493 Score = 29.9 bits (64), Expect = 1.6 Identities = 22/123 (17%), Positives = 49/123 (39%), Gaps = 1/123 (0%) Frame = +2 Query: 278 GPGTLEVPLSLFATNRRRLANKLKSGQIVVLQGGEDVNHYDTDVQYVFRQEAYFTWVCGV 457 G T + + + R++L L + ++ V V Y FRQ+A + ++ G Sbjct: 46 GEVTPGIRIEEYIGRRKKLVELLPENSLAIISSAP-VKMMTDVVPYTFRQDADYLYLTGC 104 Query: 458 REPGCYFALDVSTGKSYSLCPDFLRSMKSGWANSMP-VVTSKTYMQFDEVYYVDEIKDVL 634 ++PG L G + + + W + V + + D+ Y + ++ ++L Sbjct: 105 QQPGGVAVLSDERGLCMFMPESTPKDI--AWEGEVAGVDAASEVFKADQAYPISKLPEIL 162 Query: 635 KSL 643 + Sbjct: 163 SDM 165 >At4g35880.1 68417.m05095 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 524 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 380 EDVNHYDTDVQYVFRQEAYFTWVCGVREPGCYFALDVSTG 499 EDV H T+ + R EAY T+ CG + G + + G Sbjct: 207 EDVMHLTTEDKNPERVEAYVTFGCGQVQSGSFLDIAAPNG 246 >At2g04280.1 68415.m00420 expressed protein Length = 568 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 209 FFKPFKDKIAFHYIIDMAATW 271 FF P KDK A H++ D W Sbjct: 485 FFNPLKDKYATHFLYDYKDLW 505 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,651,045 Number of Sequences: 28952 Number of extensions: 318332 Number of successful extensions: 659 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -