BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060191.seq (565 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1012 + 23295976-23296264,23296475-23296548,23296972-232969... 27 7.8 >07_03_1012 + 23295976-23296264,23296475-23296548,23296972-23296996, 23297486-23297568,23297653-23297685,23298322-23298469, 23298625-23298722 Length = 249 Score = 27.5 bits (58), Expect = 7.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 396 LRFWFKPQMTPNERPYEAQAFFRELDSPXDFP 491 L W + P PYE FF ++ P D+P Sbjct: 85 LYHWLSTIIGPQGSPYEGGIFFLDIVFPIDYP 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,088,728 Number of Sequences: 37544 Number of extensions: 257917 Number of successful extensions: 498 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -