BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060191.seq (565 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 1.7 AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 24 3.9 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 9.1 AY146757-1|AAO12072.1| 246|Anopheles gambiae odorant-binding pr... 23 9.1 AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding pr... 23 9.1 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 25.0 bits (52), Expect = 1.7 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 377 VGSSSSRYQINIEFQLCMTRFGNAIFISFLLVDNNTS 267 +GS SR ++ F LC G+ F +L + TS Sbjct: 901 IGSWQSRKHGDVSFHLCQVLSGHGFFRDYLCRNGFTS 937 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 23.8 bits (49), Expect = 3.9 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 201 QCCGIGRFTFRCHYHLFFN 145 +CCG+ +F C+Y+ + N Sbjct: 127 KCCGLAFESFLCYYYNYGN 145 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 263 ITTAICILSLASGSTAFLST 204 +T+A C+L A+ T FLS+ Sbjct: 499 VTSAACVLGPANPKTNFLSS 518 >AY146757-1|AAO12072.1| 246|Anopheles gambiae odorant-binding protein AgamOBP39 protein. Length = 246 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 411 KPQMTPNERPYEAQAFFREL 470 +PQ + +P++AQ F R L Sbjct: 152 QPQQSTPPQPFDAQEFIRSL 171 >AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding protein OBPjj83a protein. Length = 285 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 411 KPQMTPNERPYEAQAFFREL 470 +PQ + +P++AQ F R L Sbjct: 152 QPQQSTPPQPFDAQEFIRSL 171 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,787 Number of Sequences: 2352 Number of extensions: 10932 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -