BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060190.seq (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.8 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 2.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.8 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 22 4.9 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 8.6 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 434 RVTPPMSMFSTASXTVTSGL 375 R TPP+S S ++ T +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 434 RVTPPMSMFSTASXTVTSGL 375 R TPP+S S ++ T +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 434 RVTPPMSMFSTASXTVTSGL 375 R TPP+S S ++ T +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 434 RVTPPMSMFSTASXTVTSGL 375 R TPP+S S ++ T +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 434 RVTPPMSMFSTASXTVTSGL 375 R TPP+S S ++ T +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 434 RVTPPMSMFSTASXTVTSGL 375 R TPP+S S ++ T +SGL Sbjct: 80 RSTPPLSTPSNSNATKSSGL 99 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 434 RVTPPMSMFSTASXTVTSGL 375 R TPP+S S ++ T +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 434 RVTPPMSMFSTASXTVTSGL 375 R TPP+S S ++ T +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 434 RVTPPMSMFSTASXTVTSGL 375 R TPP+S S ++ T +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 21.8 bits (44), Expect = 4.9 Identities = 17/80 (21%), Positives = 36/80 (45%), Gaps = 2/80 (2%) Frame = +1 Query: 211 STGDARRSGENFTSRVHAGILARLSDSDQEDMKRQK--YEMISVVVCNLYPFVQTVSKPD 384 ++GD GE+F +V + + ++D++ K + + V + +V K Sbjct: 49 TSGDTHLGGEDFDQKVMDYFIKMVKQKHKKDIRADKKALQKLRREVEKAKRDLSSVHKTT 108 Query: 385 VTVXDAVENIDIGGVTLLRA 444 +T+ + + + D TL RA Sbjct: 109 LTIENLLADYDF-SETLTRA 127 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -2 Query: 228 PSISGALVMSDTS*TVRPAFRSARGGTATGNQLQATF 118 PS++ A + D+ ++P + G T++ AT+ Sbjct: 174 PSVTAAPHLRDSPNYIKPQLHVSTGSTSSPTIASATY 210 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,059 Number of Sequences: 336 Number of extensions: 2758 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -