BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060189.seq (687 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45290.1 68415.m05637 transketolase, putative strong similari... 31 0.95 At1g20910.1 68414.m02618 ARID/BRIGHT DNA-binding domain-containi... 29 3.8 At4g18010.2 68417.m02680 inositol polyphosphate 5-phosphatase II... 28 5.0 At4g18010.1 68417.m02679 inositol polyphosphate 5-phosphatase II... 28 5.0 At2g04160.1 68415.m00400 subtilisin-like protease (AIR3) almost ... 28 5.0 At3g17200.1 68416.m02194 hypothetical protein 28 6.7 At2g26350.1 68415.m03163 zinc-binding peroxisomal integral membr... 28 6.7 At2g42380.2 68415.m05245 bZIP transcription factor family protein 27 8.8 At2g42380.1 68415.m05244 bZIP transcription factor family protein 27 8.8 >At2g45290.1 68415.m05637 transketolase, putative strong similarity to transketolase 1 [Capsicum annuum] GI:3559814; contains Pfam profiles PF02779: Transketolase, pyridine binding domain, PF02780: Transketolase, C-terminal domain, PF00456: Transketolase, thiamine diphosphate binding domain Length = 741 Score = 30.7 bits (66), Expect = 0.95 Identities = 29/98 (29%), Positives = 40/98 (40%), Gaps = 7/98 (7%) Frame = -2 Query: 497 IPPPAPSSGNEGSALYVQPCRA*C*KASPACDGGSQ---TSRFQCSQAFLGTFRNTRFE- 330 +P P S + + Q C KA P GGS +S +AF G F+ E Sbjct: 421 LPTYTPDSPGDATRNLSQQCLNALAKAVPGFLGGSADLASSNMTMLKAF-GNFQKATPEE 479 Query: 329 ---RGGIADHGTDQSCRGISIAGGILRNRLPGFVEVCA 225 R G+ +HG C GI++ PGF+ CA Sbjct: 480 RNLRFGVREHGMGAICNGIAL-------HSPGFIPYCA 510 >At1g20910.1 68414.m02618 ARID/BRIGHT DNA-binding domain-containing protein low similarity to Chain A, Human Mrf-2 Domain [Homo sapiens] GI:14278238; contains Pfam profile PF01388: ARID/BRIGHT DNA binding domain Length = 398 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -1 Query: 603 SNGEQLVTGHESIIGLSVQIAPFPYSGIGPTTVRFDSASRSI 478 +NGE + G I+ SV+ P + G G R DSA+R++ Sbjct: 198 NNGELNLPGSTLILSSSVEKEPSSHQGSGSGRARRDSAARAM 239 >At4g18010.2 68417.m02680 inositol polyphosphate 5-phosphatase II (IP5PII) nearly identical to inositol polyphosphate 5-phosphatase II [Arabidopsis thaliana] GI:10444263 isoform contains an AT-acceptor splice site at intron 6 Length = 613 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 329 RGGIADHGTDQSCRGISIAGGILRNRLPG 243 RG ADHG + S G+S+ GG R G Sbjct: 68 RGSEADHGNNISDGGVSVRGGYQRKHRRG 96 >At4g18010.1 68417.m02679 inositol polyphosphate 5-phosphatase II (IP5PII) nearly identical to inositol polyphosphate 5-phosphatase II [Arabidopsis thaliana] GI:10444263 isoform contains an AT-acceptor splice site at intron 6 Length = 646 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 329 RGGIADHGTDQSCRGISIAGGILRNRLPG 243 RG ADHG + S G+S+ GG R G Sbjct: 68 RGSEADHGNNISDGGVSVRGGYQRKHRRG 96 >At2g04160.1 68415.m00400 subtilisin-like protease (AIR3) almost identical to subtilisin-like protease AIR3 GI:4218991 from [Arabidopsis thaliana], missing 200 aa at N-terminus Length = 772 Score = 28.3 bits (60), Expect = 5.0 Identities = 24/103 (23%), Positives = 42/103 (40%), Gaps = 2/103 (1%) Frame = -2 Query: 308 GTDQSCRGISIAGGILRNRLPGFVEVCAHHASGVCLVGTVLDAVTHGVSVFVDFADTXCA 129 GT SC IS G+L+ R P + S + T++D + + + T + Sbjct: 559 GTSMSCPHISGIAGLLKTRYPSWSPAAIR--SAIMTTATIMDDIPGPIQNATNMKATPFS 616 Query: 128 --AVDFQARVFHVDFFVFILFIRDLVEKVVNSGYFCLMVSLLS 6 A Q + V+ L I+D + + + GY +S+ S Sbjct: 617 FGAGHVQPNLAVNPGLVYDLGIKDYLNFLCSLGYNASQISVFS 659 >At3g17200.1 68416.m02194 hypothetical protein Length = 310 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 153 NEHGDAMCNCIKDCPYET-DSRRMVCTNFNETWQSIAK 263 N+H + C+ + D P ET D VCT + W+ IAK Sbjct: 175 NQHVNTSCS-LCDEPMETRDHLFFVCTYSRKVWEDIAK 211 >At2g26350.1 68415.m03163 zinc-binding peroxisomal integral membrane protein (PEX10) identical to zinc-binding peroxisomal integral membrane protein GI:4337011 from [Arabidopsis thaliana] Length = 381 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 318 NTTTFKSSITERAEKCLTALKARCLTSPVACGTGFLTSC-ATWLN 449 N +T S+ TE KC L R + CG F SC W N Sbjct: 312 NWSTSDSTSTEAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWCN 356 >At2g42380.2 68415.m05245 bZIP transcription factor family protein Length = 321 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 127 AAQXVSAKSTNTETPCVTASRTVPTRQTPDAWCAQTSTKPGNRLRSI 267 ++Q +S ST T T TA+ TV D + ++++ GN RSI Sbjct: 19 SSQKLSPFSTPTATAVATATTTVQNPSWVDEFLDFSASRRGNHRRSI 65 >At2g42380.1 68415.m05244 bZIP transcription factor family protein Length = 310 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 127 AAQXVSAKSTNTETPCVTASRTVPTRQTPDAWCAQTSTKPGNRLRSI 267 ++Q +S ST T T TA+ TV D + ++++ GN RSI Sbjct: 19 SSQKLSPFSTPTATAVATATTTVQNPSWVDEFLDFSASRRGNHRRSI 65 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,852,151 Number of Sequences: 28952 Number of extensions: 322200 Number of successful extensions: 904 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -