BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060188.seq (647 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding pr... 25 1.6 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 6.3 >AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding protein AgamOBP14 protein. Length = 188 Score = 25.4 bits (53), Expect = 1.6 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -2 Query: 283 ITVLRCIVAFSASPFSAGESSGASSVPFSLPLLSAASTFLXGDFL 149 I L ++ A SA ++S +P + A STF+ DFL Sbjct: 6 IATLTVLLVLLAGTASAKKASTIFGMPLQQDPVPATSTFIVSDFL 50 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 249 HHHFQQANLLGLHRYHSL 196 HHH A+L G H H++ Sbjct: 510 HHHPTAADLAGYHHQHNV 527 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 521,299 Number of Sequences: 2352 Number of extensions: 8204 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -