BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060181.seq (660 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0047 + 19595904-19596185,19596284-19596424,19597195-195973... 28 5.7 >11_06_0047 + 19595904-19596185,19596284-19596424,19597195-19597307, 19597970-19598049,19598557-19598720,19598931-19599060, 19599155-19599254,19599452-19599500,19599775-19599849, 19600026-19600124,19600745-19600823,19600897-19601045, 19601334-19601393,19601490-19601684 Length = 571 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -2 Query: 479 ITFTDVTIDRLQFASNFENIVCTYKQWLWGI--LLFITLFMYY 357 I + ++ + FA NF I W WG L F +L M+Y Sbjct: 291 IVLITLFLNSIIFAPNFSRITAAVGIWSWGAISLAFASLVMFY 333 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,028,824 Number of Sequences: 37544 Number of extensions: 274913 Number of successful extensions: 769 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -