BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060179.seq (683 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023913-1|ABA81847.1| 284|Drosophila melanogaster AT13385p pro... 29 5.9 BT012336-1|AAS77461.1| 284|Drosophila melanogaster AT16075p pro... 29 5.9 AE013599-633|AAM68841.1| 284|Drosophila melanogaster CG30366-PA... 29 5.9 >BT023913-1|ABA81847.1| 284|Drosophila melanogaster AT13385p protein. Length = 284 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 193 LVR*DPKIPWARGLLPTLCRSLSPIYPRREHPVGGSAHGPKKKKICME 50 L R +P+ +RG PTLC L YP + G+ K++ +C+E Sbjct: 220 LARCNPRC--SRGRKPTLCTKLRAPYPCYSEKIRGTRPLRKRECLCLE 265 >BT012336-1|AAS77461.1| 284|Drosophila melanogaster AT16075p protein. Length = 284 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 193 LVR*DPKIPWARGLLPTLCRSLSPIYPRREHPVGGSAHGPKKKKICME 50 L R +P+ +RG PTLC L YP + G+ K++ +C+E Sbjct: 220 LARCNPRC--SRGRKPTLCTKLRAPYPCYSEKIRGTRPLRKRECLCLE 265 >AE013599-633|AAM68841.1| 284|Drosophila melanogaster CG30366-PA protein. Length = 284 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 193 LVR*DPKIPWARGLLPTLCRSLSPIYPRREHPVGGSAHGPKKKKICME 50 L R +P+ +RG PTLC L YP + G+ K++ +C+E Sbjct: 220 LARCNPRC--SRGRKPTLCTKLRAPYPCYSEKIRGTRPLRKRECLCLE 265 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,795,065 Number of Sequences: 53049 Number of extensions: 526947 Number of successful extensions: 937 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2992560750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -