BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060178.seq (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 24 1.6 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 24 1.6 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 6.3 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 6.3 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 6.3 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 3 ARGELQHRPLLVDLTIEEGTRLKVIYGSADGFHAVDLD 116 A G+L +DL + GT+ + I+GS++ A+DLD Sbjct: 84 ASGDLSLGQKTIDLELI-GTQAEGIFGSSEECVALDLD 120 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 3 ARGELQHRPLLVDLTIEEGTRLKVIYGSADGFHAVDLD 116 A G+L +DL + GT+ + I+GS++ A+DLD Sbjct: 52 ASGDLSLGQKTIDLELI-GTQAEGIFGSSEECVALDLD 88 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 6.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 33 LVDLTIEEGTRLKVIYGSADGFHAVDLDTATVYDIYIPK 149 +V + E+G L V + S D FH + T+ +D Y PK Sbjct: 202 MVYIADEKGEGLIVYHNSDDSFHRL---TSNTFD-YDPK 236 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 6.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 33 LVDLTIEEGTRLKVIYGSADGFHAVDLDTATVYDIYIPK 149 +V + E+G L V + S D FH + T+ +D Y PK Sbjct: 202 MVYIADEKGEGLIVYHNSDDSFHRL---TSNTFD-YDPK 236 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 6.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 33 LVDLTIEEGTRLKVIYGSADGFHAVDLDTATVYDIYIPK 149 +V + E+G L V + S D FH + T+ +D Y PK Sbjct: 202 MVYIADEKGEGLIVYHNSDDSFHRL---TSNTFD-YDPK 236 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,085 Number of Sequences: 438 Number of extensions: 5472 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -