BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060175.seq (690 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_21172| Best HMM Match : LIM (HMM E-Value=1.3) 28 8.2 >SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2708 Score = 31.1 bits (67), Expect = 0.88 Identities = 22/102 (21%), Positives = 42/102 (41%), Gaps = 2/102 (1%) Frame = +2 Query: 2 GTRSSVTMSAIALYLEINKLRLKIDEPMQLAIWPQIFPLLCDEHQNVQLNTDVLINFIMH 181 GT V+ + Y ++K ++ P + +W PL+ + + V N L+ F H Sbjct: 1903 GTTKLVSFFVVMNYCLVSKTEKEMFTPFCVDLWRLFHPLMSEPNIAVHHNKQALLIFWYH 1962 Query: 182 VARKSQNTI--LNNNAAIASQYAAGNGASSSQRQVPPILRRV 301 V + + + + +A+ A SS + +V R V Sbjct: 1963 VCMDCEVNVAFITDTTQVANNIALNYILSSDEPEVITFNRNV 2004 >SB_21172| Best HMM Match : LIM (HMM E-Value=1.3) Length = 274 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 459 HVADFVFCRTGAVQR 415 H+AD+V+CRTG R Sbjct: 51 HLADYVYCRTGVAHR 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,422,954 Number of Sequences: 59808 Number of extensions: 352043 Number of successful extensions: 966 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 966 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -