BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060175.seq (690 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 3.0 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 24 5.2 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.6 bits (51), Expect = 3.0 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 390 CSQTNPSLFVEQHQ--FYRIQNQRRGHDHDIFAGD 488 C +PS V + + RI RGH +FAGD Sbjct: 87 CCYVSPSAGVSEFEEVMQRIDVLARGHPRVVFAGD 121 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 198 CDLRATCIIKFINTSVF 148 C+ +A CI F NT V+ Sbjct: 156 CNFKAYCIFSFFNTIVY 172 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,635 Number of Sequences: 2352 Number of extensions: 12082 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -