BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060172.seq (684 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC5H10.05c |||FAD binding oxidoreductasde |Schizosaccharomyces... 26 4.4 SPBC20F10.02c |||DUF1741 family protein|Schizosaccharomyces pomb... 26 5.8 SPAC23H4.02 |ppk9||serine/threonine protein kinase Ppk9 |Schizos... 25 7.7 SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr... 25 7.7 SPAC22H10.10 |alp21|sto1|tubulin specific chaperone cofactor E|S... 25 7.7 >SPAC5H10.05c |||FAD binding oxidoreductasde |Schizosaccharomyces pombe|chr 1|||Manual Length = 196 Score = 26.2 bits (55), Expect = 4.4 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 220 FGRIRKQFGLDDRNVVTFFGKGFNIHFVDYMVAVSW 113 +G++ G +N +GKG +H YM++ +W Sbjct: 89 YGQLYANDGRSSKNPTQNYGKGGLLHEHRYMISCTW 124 >SPBC20F10.02c |||DUF1741 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 600 Score = 25.8 bits (54), Expect = 5.8 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 352 YLGLIEMFKDQFDNINVRNLIANNQTF 432 YL + E+ K + +++ +RN +A QTF Sbjct: 70 YLYISEILKSKAESLRIRNSLATLQTF 96 >SPAC23H4.02 |ppk9||serine/threonine protein kinase Ppk9 |Schizosaccharomyces pombe|chr 1|||Manual Length = 532 Score = 25.4 bits (53), Expect = 7.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 150 LKPLPKNVTTLRSSSP 197 + P+P NV TLRSS P Sbjct: 383 IPPIPSNVETLRSSLP 398 >SPAPJ691.02 |||yippee-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 131 Score = 25.4 bits (53), Expect = 7.7 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 10 VIRVEAKNDYSLLACTAV-YAYCCKCGQYIGRVSYASLQP 126 VI +E K + V + +CC+C YIG +S +P Sbjct: 50 VIEMEPKTEQMSTGRFIVRHIHCCRCHTYIGWKYVSSYEP 89 >SPAC22H10.10 |alp21|sto1|tubulin specific chaperone cofactor E|Schizosaccharomyces pombe|chr 1|||Manual Length = 511 Score = 25.4 bits (53), Expect = 7.7 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = -1 Query: 525 VARRDLITGARIVQVAKHQRIIGKRFHDN*IKRLVVGNEIAHVD 394 +AR + V ++ ++R+ + ++ + I++LV+ NEI V+ Sbjct: 339 IARIPSLVKLNDVNISPNERLDAELYYTSCIRKLVIDNEIKDVE 382 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,874,326 Number of Sequences: 5004 Number of extensions: 59750 Number of successful extensions: 147 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -