BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060171.seq (724 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.20 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 25 0.62 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 25 0.82 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 24 1.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.6 bits (56), Expect = 0.20 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -2 Query: 126 ENKGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWSYRV 13 E+ +Y + +LVP +C+PG E W Y+V Sbjct: 1216 ESCSSFYVCVNGHLVPQNCAPGLHYNPEEHMCDWKYKV 1253 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 25.0 bits (52), Expect = 0.62 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -2 Query: 165 IYTLWRELWKKDQENKGKWYGSIQDNLVPNSCSPGDPLVLERP 37 IY +L+ ++N+ +W SI+ +L N C P ++P Sbjct: 166 IYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKP 208 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 24.6 bits (51), Expect = 0.82 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 129 QENKGKWYGSIQDNLVPNSC 70 +ENK W SI+ NL N C Sbjct: 121 RENKQGWQNSIRHNLSLNKC 140 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 114 KWYGSIQDNLVPNSCSPGDPLVLERP 37 +W S Q VPN +P ++RP Sbjct: 23 RWLNSQQPRNVPNFAAPSTSTAVQRP 48 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,176 Number of Sequences: 336 Number of extensions: 3932 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -