BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060171.seq (724 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 54 1e-07 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 54 2e-07 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 53 2e-07 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 53 2e-07 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) 53 2e-07 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 53 2e-07 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) 53 2e-07 SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09) 53 2e-07 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 53 2e-07 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) 53 2e-07 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 53 2e-07 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 53 3e-07 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 53 3e-07 SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4) 53 3e-07 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 53 3e-07 SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) 53 3e-07 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 53 3e-07 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 53 3e-07 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) 53 3e-07 SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) 53 3e-07 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 52 4e-07 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 52 5e-07 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 52 5e-07 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 52 5e-07 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 52 6e-07 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 52 6e-07 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 51 8e-07 SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 51 8e-07 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 51 8e-07 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 51 1e-06 SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) 51 1e-06 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 51 1e-06 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73) 51 1e-06 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 51 1e-06 SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 51 1e-06 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 50 1e-06 SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) 50 1e-06 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 50 1e-06 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) 50 1e-06 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 50 1e-06 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 50 1e-06 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 50 2e-06 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 50 2e-06 SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) 50 2e-06 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 50 2e-06 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 50 2e-06 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 50 2e-06 SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) 50 2e-06 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 50 2e-06 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 50 2e-06 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 50 2e-06 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 50 2e-06 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) 50 2e-06 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 50 2e-06 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 50 2e-06 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 50 2e-06 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 50 2e-06 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 50 2e-06 SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) 50 2e-06 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 50 3e-06 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_27420| Best HMM Match : PHB_acc (HMM E-Value=6.6) 50 3e-06 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 50 3e-06 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 50 3e-06 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_7956| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) 50 3e-06 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 50 3e-06 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 50 3e-06 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 49 3e-06 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 49 3e-06 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 49 3e-06 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 49 3e-06 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 49 3e-06 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 49 3e-06 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 49 3e-06 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 49 3e-06 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 49 3e-06 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 49 3e-06 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 49 3e-06 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 49 3e-06 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 49 3e-06 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 49 3e-06 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 49 3e-06 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 49 3e-06 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 49 3e-06 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 49 3e-06 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 49 3e-06 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 49 3e-06 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 49 3e-06 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 49 3e-06 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 49 3e-06 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 49 3e-06 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 56.0 bits (129), Expect = 3e-08 Identities = 27/77 (35%), Positives = 45/77 (58%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T + PI K + A+ YRPI+L+S K+ E ++ + +++ +HI+ D Q+GF Sbjct: 221 WLTANICPIYKKGAKKDPAN-YRPIALTSVTCKVMEHIVYHHIYAHLDRHHILRDFQHGF 279 Query: 322 RRGRSCADSFISLISDL 272 R+GRSC I + D+ Sbjct: 280 RKGRSCETQLIITVDDI 296 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/33 (72%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = -2 Query: 114 KWYGSIQD--NLVPNSCSPGDPLVLERPPPRWS 22 ++YGS Q+ +L NSCSPGDPLVLERPPPRWS Sbjct: 202 RYYGSAQNGKHLRSNSCSPGDPLVLERPPPRWS 234 >SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1251 Score = 54.4 bits (125), Expect = 9e-08 Identities = 26/77 (33%), Positives = 44/77 (57%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T + PI K + A+ YRPI+L+S K+ E ++ + +++ +HI+ D Q+ F Sbjct: 687 WLTANICPIYKKGAKKDPAN-YRPIALTSVTCKVMEHIVYYHIYAHLDRHHILRDFQHAF 745 Query: 322 RRGRSCADSFISLISDL 272 R+GRSC I + D+ Sbjct: 746 RKGRSCETQLIITVDDI 762 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 54.4 bits (125), Expect = 9e-08 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -2 Query: 93 DNLVPNSCSPGDPLVLERPPPRWS 22 DN+ NSCSPGDPLVLERPPPRWS Sbjct: 35 DNIASNSCSPGDPLVLERPPPRWS 58 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 54.4 bits (125), Expect = 9e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 108 YGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 YG I +V NSCSPGDPLVLERPPPRWS Sbjct: 12 YGLIVLTVVSNSCSPGDPLVLERPPPRWS 40 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 54.4 bits (125), Expect = 9e-08 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N+V NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIVSNSCSPGDPLVLERPPPRWS 34 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 54.0 bits (124), Expect = 1e-07 Identities = 22/29 (75%), Positives = 25/29 (86%), Gaps = 1/29 (3%) Frame = -2 Query: 105 GSIQDNL-VPNSCSPGDPLVLERPPPRWS 22 G +QD + + NSCSPGDPLVLERPPPRWS Sbjct: 43 GPVQDEIKISNSCSPGDPLVLERPPPRWS 71 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 54.0 bits (124), Expect = 1e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N++ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIISNSCSPGDPLVLERPPPRWS 34 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 54.0 bits (124), Expect = 1e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -2 Query: 114 KWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 K+ G++ + V NSCSPGDPLVLERPPPRWS Sbjct: 5 KFPGAVNRDEVSNSCSPGDPLVLERPPPRWS 35 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 54.0 bits (124), Expect = 1e-07 Identities = 31/62 (50%), Positives = 39/62 (62%), Gaps = 5/62 (8%) Frame = -2 Query: 192 DYFLN--IKENIYTLWRELWKKDQENKGKW-YGSI--QDNLVPNSCSPGDPLVLERPPPR 28 D LN KE IY ++R L Q + ++ + S+ + L NSCSPGDPLVLERPPPR Sbjct: 45 DEMLNKGFKEQIYDVYRYLPPATQNSYVEYLHESVPKSEPLSSNSCSPGDPLVLERPPPR 104 Query: 27 WS 22 WS Sbjct: 105 WS 106 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 54.0 bits (124), Expect = 1e-07 Identities = 27/77 (35%), Positives = 45/77 (58%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T + PI K A + +YRPI+L+S K+ E ++ + +++ +HI+ D Q+GF Sbjct: 289 WLTANICPIYKKG-AKKDPVNYRPIALTSVTCKVMEHIVYHYIYAHLDRHHILRDFQHGF 347 Query: 322 RRGRSCADSFISLISDL 272 R+GRSC I + D+ Sbjct: 348 RKGRSCETQLIITVDDI 364 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 54.0 bits (124), Expect = 1e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N++ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIISNSCSPGDPLVLERPPPRWS 34 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -2 Query: 147 ELWKKDQENKGKWYGSIQDNLVP-NSCSPGDPLVLERPPPRWS 22 +LW+ + S+ + P NSCSPGDPLVLERPPPRWS Sbjct: 493 KLWRLGESGSASARESVPSSSTPSNSCSPGDPLVLERPPPRWS 535 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 66 PGDPLVLERPPPRWS 22 PGDPLVLERPPPRWS Sbjct: 664 PGDPLVLERPPPRWS 678 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK + I K + +YRP+SL+S + K+ E ++ + ++ AN+II +Q+GF Sbjct: 141 WKDANISAIYKKGLRSD-PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGF 199 Query: 322 RRGRSCADSFISLISD 275 +G SC+ IS+I D Sbjct: 200 LKGLSCSTQLISVIHD 215 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK + I K + +YRP+SL+S + K+ E ++ + ++ AN+II +Q+GF Sbjct: 653 WKDANISAIYKKGLRSD-PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGF 711 Query: 322 RRGRSCADSFISLISD 275 +G SC+ IS+I D Sbjct: 712 LKGLSCSTQLISVIHD 727 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N++ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANILSNSCSPGDPLVLERPPPRWS 34 >SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 295 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK + I K + +YRP+SL+S + K+ E ++ + ++ AN+II +Q+GF Sbjct: 51 WKDANISAIYKKGLRSD-PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGF 109 Query: 322 RRGRSCADSFISLISD 275 +G SC+ IS+I D Sbjct: 110 LKGLSCSTQLISVIHD 125 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 53.2 bits (122), Expect = 2e-07 Identities = 28/76 (36%), Positives = 42/76 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T V+P+ K D S+YRPISL+ K+ E ++ L+ ++ A +I+ D+Q+GF Sbjct: 445 WSTAKVVPVHKKDNRDN-PSNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGF 503 Query: 322 RRGRSCADSFISLISD 275 R G SC I D Sbjct: 504 RSGFSCETQLILATHD 519 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -2 Query: 120 KGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 K KW+ D + NSCSPGDPLVLERPPPRWS Sbjct: 3 KCKWFDIKHD--ISNSCSPGDPLVLERPPPRWS 33 >SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) Length = 723 Score = 53.2 bits (122), Expect = 2e-07 Identities = 28/78 (35%), Positives = 44/78 (56%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 317 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 375 Query: 322 RRGRSCADSFISLISDLD 269 R+ R+C I DL+ Sbjct: 376 RKRRNCETQLIITCHDLN 393 >SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09) Length = 748 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK + I K + +YRP+SL+S + K+ E ++ + ++ AN+II +Q+GF Sbjct: 615 WKDANISAIYKKGLRSD-PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGF 673 Query: 322 RRGRSCADSFISLISD 275 +G SC+ IS+I D Sbjct: 674 LKGLSCSTQLISVIHD 689 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK + I K + +YRP+SL+S + K+ E ++ + ++ AN+II +Q+GF Sbjct: 142 WKDANISAIYKKGLRSD-PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGF 200 Query: 322 RRGRSCADSFISLISD 275 +G SC+ IS+I D Sbjct: 201 LKGLSCSTQLISVIHD 216 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 53.2 bits (122), Expect = 2e-07 Identities = 28/76 (36%), Positives = 42/76 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T V+P+ K D S+YRPISL+ K+ E ++ L+ ++ A +I+ D+Q+GF Sbjct: 1835 WSTAKVVPVHKKDNRDN-PSNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGF 1893 Query: 322 RRGRSCADSFISLISD 275 R G SC I D Sbjct: 1894 RSGFSCETQLILATHD 1909 >SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) Length = 275 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK + I K + +YRP+SL+S + K+ E ++ + ++ AN+II +Q+GF Sbjct: 50 WKDANISAIYKKGLRSD-PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGF 108 Query: 322 RRGRSCADSFISLISD 275 +G SC+ IS+I D Sbjct: 109 LKGLSCSTQLISVIHD 124 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = -2 Query: 138 KKDQENKGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 + + +G+ ++ +V NSCSPGDPLVLERPPPRWS Sbjct: 68 QNSNDRRGEECLTLTQRIVSNSCSPGDPLVLERPPPRWS 106 >SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 53.2 bits (122), Expect = 2e-07 Identities = 30/86 (34%), Positives = 45/86 (52%) Frame = -1 Query: 508 QAWKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQY 329 Q W T V+P+ K D +YRPISL+ K+ E ++ L+ ++ A +I+ D+Q+ Sbjct: 121 QDWSTAKVVPVHKKDNRDN-PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQH 179 Query: 328 GFRRGRSCADSFISLISDLDITPPSY 251 GFR G SC I D T S+ Sbjct: 180 GFRSGFSCETQLILATHDWGSTLNSH 205 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK + I K + +YRP+SL+S + K+ E ++ + ++ AN+II +Q+GF Sbjct: 585 WKDANISAIYKKGLRSD-PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGF 643 Query: 322 RRGRSCADSFISLISD 275 +G SC+ IS+I D Sbjct: 644 LKGLSCSTQLISVIHD 659 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 113 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 171 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 172 RKRRNCETQLIITCHDL 188 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N+ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIASNSCSPGDPLVLERPPPRWS 34 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 113 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 171 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 172 RKRRNCETQLIITCHDL 188 >SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4) Length = 465 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 390 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 448 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 449 RKRRNCETQLIITYHDL 465 >SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 668 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 216 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHIICHHVWQHLEQHGILSDFQHGF 274 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 275 RKRRNCETQLIITCHDL 291 >SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) Length = 547 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 432 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 490 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 491 RKRRNCETQLIITYHDL 507 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%) Frame = -1 Query: 502 WKTQCVIPILKP-DKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYG 326 WK V PI K DK + A +YRPISL+ K+ E ++ + ++E + I+ Q+G Sbjct: 435 WKKALVTPIFKKGDK--DYAGNYRPISLTCICSKLLEHIITKNIVSHLEHHDILYKFQHG 492 Query: 325 FRRGRSCADSFISLISDL 272 FR+ RSC I ++D+ Sbjct: 493 FRKLRSCESQLIEFVNDI 510 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 IQ L NSCSPGDPLVLERPPPRWS Sbjct: 2 IQTGLPSNSCSPGDPLVLERPPPRWS 27 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I D+ + NSCSPGDPLVLERPPPRWS Sbjct: 2 IADDEISNSCSPGDPLVLERPPPRWS 27 >SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 811 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 216 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 274 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 275 RKRRNCETQLIITCHDL 291 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N+ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANITSNSCSPGDPLVLERPPPRWS 34 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.8 bits (121), Expect = 3e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N++ NSCSPGDPLVLERPPPRWS Sbjct: 4 NVISNSCSPGDPLVLERPPPRWS 26 >SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) Length = 832 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 432 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 490 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 491 RKRRNCETQLIITCHDL 507 >SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 913 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 671 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 729 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 730 RKRRNCETQLIITYHDL 746 >SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) Length = 510 Score = 52.8 bits (121), Expect = 3e-07 Identities = 25/59 (42%), Positives = 40/59 (67%) Frame = -1 Query: 451 LASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGFRRGRSCADSFISLISD 275 LAS+YRPISL+S + KI E ++ ++ ++EA+ I+ D Q+ FR+ RSC +I+D Sbjct: 112 LASNYRPISLTSVICKILEHIVCSHINRHLEAHQILSDRQHAFRKKRSCVTQLCFVIND 170 >SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) Length = 242 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 113 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 171 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 172 RKRRNCETQLIITCHDL 188 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 +LV NSCSPGDPLVLERPPPRWS Sbjct: 23 HLVSNSCSPGDPLVLERPPPRWS 45 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +L+ NSCSPGDPLVLERPPPRWS Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 96 QDNLVPNSCSPGDPLVLERPPPRWS 22 Q ++ NSCSPGDPLVLERPPPRWS Sbjct: 116 QKEIISNSCSPGDPLVLERPPPRWS 140 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -2 Query: 117 GKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 G W G++ + NSCSPGDPLVLERPPPRWS Sbjct: 54 GLWSGALSQS---NSCSPGDPLVLERPPPRWS 82 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -2 Query: 147 ELWKKDQENKGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 EL K E K +++ V NSCSPGDPLVLERPPPRWS Sbjct: 1046 ELEKLRLERSAK-KSELEEKEVSNSCSPGDPLVLERPPPRWS 1086 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 52.4 bits (120), Expect = 4e-07 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 7/49 (14%) Frame = -2 Query: 147 ELWKKDQE--NKGKWYGSIQDNLVP-----NSCSPGDPLVLERPPPRWS 22 ELW K NK + +++ P NSCSPGDPLVLERPPPRWS Sbjct: 7 ELWGKKSNTCNKNTTFSTLKTKNAPLKLSSNSCSPGDPLVLERPPPRWS 55 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +L+ NSCSPGDPLVLERPPPRWS Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +L+ NSCSPGDPLVLERPPPRWS Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +L+ NSCSPGDPLVLERPPPRWS Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +L+ NSCSPGDPLVLERPPPRWS Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 52.4 bits (120), Expect = 4e-07 Identities = 28/77 (36%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 1839 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWKHLEQHGILSDFQHGF 1897 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C I DL Sbjct: 1898 RKRRNCETQLIITCHDL 1914 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +L+ NSCSPGDPLVLERPPPRWS Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +L+ NSCSPGDPLVLERPPPRWS Sbjct: 29 TVSISLISNSCSPGDPLVLERPPPRWS 55 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 + + +V NSCSPGDPLVLERPPPRWS Sbjct: 2 VGEGIVSNSCSPGDPLVLERPPPRWS 27 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N V NSCSPGDPLVLERPPPRWS Sbjct: 21 NAVSNSCSPGDPLVLERPPPRWS 43 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +L+ NSCSPGDPLVLERPPPRWS Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +L+ NSCSPGDPLVLERPPPRWS Sbjct: 26 TVSISLISNSCSPGDPLVLERPPPRWS 52 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -2 Query: 108 YGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 Y ++V NSCSPGDPLVLERPPPRWS Sbjct: 340 YPQYLHSIVSNSCSPGDPLVLERPPPRWS 368 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I+ + V NSCSPGDPLVLERPPPRWS Sbjct: 2 IKSDRVSNSCSPGDPLVLERPPPRWS 27 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -2 Query: 108 YGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 +G ++ ++ NSCSPGDPLVLERPPPRWS Sbjct: 104 WGRLKRSVESNSCSPGDPLVLERPPPRWS 132 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -2 Query: 96 QDNLVPNSCSPGDPLVLERPPPRWS 22 Q N+ NSCSPGDPLVLERPPPRWS Sbjct: 38 QANVPSNSCSPGDPLVLERPPPRWS 62 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 LV NSCSPGDPLVLERPPPRWS Sbjct: 3 LVSNSCSPGDPLVLERPPPRWS 24 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 +L+ NSCSPGDPLVLERPPPRWS Sbjct: 36 DLISNSCSPGDPLVLERPPPRWS 58 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 LV NSCSPGDPLVLERPPPRWS Sbjct: 17 LVSNSCSPGDPLVLERPPPRWS 38 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 +QD NSCSPGDPLVLERPPPRWS Sbjct: 183 VQDLCKSNSCSPGDPLVLERPPPRWS 208 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 LV NSCSPGDPLVLERPPPRWS Sbjct: 9 LVSNSCSPGDPLVLERPPPRWS 30 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 52.0 bits (119), Expect = 5e-07 Identities = 29/84 (34%), Positives = 44/84 (52%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T V+P+ K D +YRPISL+ K+ E ++ L+ ++ A +I+ D+Q+GF Sbjct: 1171 WSTAKVVPVHKKDNRDN-PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGF 1229 Query: 322 RRGRSCADSFISLISDLDITPPSY 251 R G SC I D T S+ Sbjct: 1230 RSGFSCETQLILATHDWGSTLNSH 1253 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 +L+ NSCSPGDPLVLERPPPRWS Sbjct: 32 SLISNSCSPGDPLVLERPPPRWS 54 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 + ++ V NSCSPGDPLVLERPPPRWS Sbjct: 6 VSNDAVSNSCSPGDPLVLERPPPRWS 31 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 SI+ NSCSPGDPLVLERPPPRWS Sbjct: 7 SIKQQATSNSCSPGDPLVLERPPPRWS 33 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 LV NSCSPGDPLVLERPPPRWS Sbjct: 5 LVSNSCSPGDPLVLERPPPRWS 26 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 LV NSCSPGDPLVLERPPPRWS Sbjct: 2 LVSNSCSPGDPLVLERPPPRWS 23 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 ++D + NSCSPGDPLVLERPPPRWS Sbjct: 6 MEDEIRSNSCSPGDPLVLERPPPRWS 31 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N+ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIPSNSCSPGDPLVLERPPPRWS 34 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N+ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIQSNSCSPGDPLVLERPPPRWS 34 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 +L+ NSCSPGDPLVLERPPPRWS Sbjct: 39 HLISNSCSPGDPLVLERPPPRWS 61 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 52.0 bits (119), Expect = 5e-07 Identities = 29/84 (34%), Positives = 44/84 (52%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T V+P+ K D +YRPISL+ K+ E ++ L+ ++ A +I+ D+Q+GF Sbjct: 155 WSTAKVVPVHKKDNRDN-PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGF 213 Query: 322 RRGRSCADSFISLISDLDITPPSY 251 R G SC I D T S+ Sbjct: 214 RSGFSCETQLILATHDWGSTLNSH 237 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 LV NSCSPGDPLVLERPPPRWS Sbjct: 26 LVSNSCSPGDPLVLERPPPRWS 47 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 LV NSCSPGDPLVLERPPPRWS Sbjct: 26 LVSNSCSPGDPLVLERPPPRWS 47 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 105 GSIQDNLVPNSCSPGDPLVLERPPPRWS 22 G D + NSCSPGDPLVLERPPPRWS Sbjct: 6 GRASDIVASNSCSPGDPLVLERPPPRWS 33 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N+ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIPSNSCSPGDPLVLERPPPRWS 34 >SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 52.0 bits (119), Expect = 5e-07 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -2 Query: 117 GKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 G W+ +Q + NSCSPGDPLVLERPPPRWS Sbjct: 32 GFWFRRLQIS-TSNSCSPGDPLVLERPPPRWS 62 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N V NSCSPGDPLVLERPPPRWS Sbjct: 8 NSVSNSCSPGDPLVLERPPPRWS 30 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 NL NSCSPGDPLVLERPPPRWS Sbjct: 19 NLRSNSCSPGDPLVLERPPPRWS 41 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 17 LISNSCSPGDPLVLERPPPRWS 38 >SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 51.6 bits (118), Expect = 6e-07 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T V+P+ K D +YRPISL+ K+ E ++ L+ ++ A +I+ D+Q+GF Sbjct: 104 WSTAKVVPVHKKDNRDN-PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGF 162 Query: 322 RRGRSCADSFISLISD 275 R G SC I D Sbjct: 163 RSGFSCETQLILATHD 178 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 51.6 bits (118), Expect = 6e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 108 YGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 YG I + NSCSPGDPLVLERPPPRWS Sbjct: 3 YGLIVLTVGSNSCSPGDPLVLERPPPRWS 31 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -2 Query: 105 GSIQDNLVPNSCSPGDPLVLERPPPRWS 22 G+ + + NSCSPGDPLVLERPPPRWS Sbjct: 76 GAKRQQMASNSCSPGDPLVLERPPPRWS 103 >SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 411 Score = 51.6 bits (118), Expect = 6e-07 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T V+P+ K D +YRPISL+ K+ E ++ L+ ++ A +I+ D+Q+GF Sbjct: 53 WSTAKVVPVHKKDNRDN-PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGF 111 Query: 322 RRGRSCADSFISLISD 275 R G SC I D Sbjct: 112 RSGFSCETQLILATHD 127 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N V NSCSPGDPLVLERPPPRWS Sbjct: 115 NEVSNSCSPGDPLVLERPPPRWS 137 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 51.6 bits (118), Expect = 6e-07 Identities = 25/61 (40%), Positives = 36/61 (59%) Frame = -2 Query: 204 ISFTDYFLNIKENIYTLWRELWKKDQENKGKWYGSIQDNLVPNSCSPGDPLVLERPPPRW 25 + T+ + +E I+++ + Q +K K ++ NSCSPGDPLVLERPPPRW Sbjct: 62 LGLTEQHEDKQECIHSIGAYRTTRRQTSKVKKKNAVTRIRTSNSCSPGDPLVLERPPPRW 121 Query: 24 S 22 S Sbjct: 122 S 122 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 51.6 bits (118), Expect = 6e-07 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 WK V+PI K K ++YRP+SL+S KI E ++ + ++E + I+ D Q+GF Sbjct: 674 WKIANVVPIFKKGKRSS-PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGF 732 Query: 322 RRGRSCADSFISLISDL 272 R+ R+C + DL Sbjct: 733 RKRRNCETQLMITCHDL 749 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -2 Query: 93 DNLVPNSCSPGDPLVLERPPPRWS 22 + +V NSCSPGDPLVLERPPPRWS Sbjct: 75 NTIVSNSCSPGDPLVLERPPPRWS 98 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 8 LISNSCSPGDPLVLERPPPRWS 29 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N+ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIGSNSCSPGDPLVLERPPPRWS 34 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 51.6 bits (118), Expect = 6e-07 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = -2 Query: 120 KGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 K K S ++ + NSCSPGDPLVLERPPPRWS Sbjct: 35 KKKLKASKKNFFISNSCSPGDPLVLERPPPRWS 67 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 24 LISNSCSPGDPLVLERPPPRWS 45 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.6 bits (118), Expect = 6e-07 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 114 KWYGSIQDNLV-PNSCSPGDPLVLERPPPRWS 22 KW ++ V NSCSPGDPLVLERPPPRWS Sbjct: 3 KWPSELEKRQVLSNSCSPGDPLVLERPPPRWS 34 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 51.6 bits (118), Expect = 6e-07 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = -2 Query: 141 WKKDQENKGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 W +K W I DN NSCSPGDPLVLERPPPRWS Sbjct: 60 WHASSVSKKDW---IVDN-PSNSCSPGDPLVLERPPPRWS 95 >SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N+ NSCSPGDPLVLERPPPRWS Sbjct: 6 NVTSNSCSPGDPLVLERPPPRWS 28 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 70 LISNSCSPGDPLVLERPPPRWS 91 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N+ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIRSNSCSPGDPLVLERPPPRWS 34 >SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 51.6 bits (118), Expect = 6e-07 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T V+P+ K D +YRPISL+ K+ E ++ L+ ++ A +I+ D+Q+GF Sbjct: 45 WSTAKVVPVHKKDNRDN-PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGF 103 Query: 322 RRGRSCADSFISLISD 275 R G SC I D Sbjct: 104 RSGFSCETQLILATHD 119 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 + D + NSCSPGDPLVLERPPPRWS Sbjct: 9 VTDEIRSNSCSPGDPLVLERPPPRWS 34 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 21 LISNSCSPGDPLVLERPPPRWS 42 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N + NSCSPGDPLVLERPPPRWS Sbjct: 61 NFLSNSCSPGDPLVLERPPPRWS 83 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 16 LISNSCSPGDPLVLERPPPRWS 37 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 51.6 bits (118), Expect = 6e-07 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = -1 Query: 502 WKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGF 323 W T V+P+ K D +YRPISL+ K+ E ++ L+ ++ A +I+ D+Q+GF Sbjct: 184 WSTAKVVPVHKKDNRDN-PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGF 242 Query: 322 RRGRSCADSFISLISD 275 R G SC I D Sbjct: 243 RSGFSCETQLILATHD 258 >SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I N+ NSCSPGDPLVLERPPPRWS Sbjct: 9 ISANIGSNSCSPGDPLVLERPPPRWS 34 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 51.6 bits (118), Expect = 6e-07 Identities = 30/59 (50%), Positives = 35/59 (59%) Frame = -2 Query: 198 FTDYFLNIKENIYTLWRELWKKDQENKGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 FTD I NIY L R+ +NK ++ + NSCSPGDPLVLERPPPRWS Sbjct: 4 FTDTL--ISANIYLLKRQC--HTSQNKRP-----ENKALSNSCSPGDPLVLERPPPRWS 53 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 96 QDNLVPNSCSPGDPLVLERPPPRWS 22 Q+++ NSCSPGDPLVLERPPPRWS Sbjct: 31 QESIRSNSCSPGDPLVLERPPPRWS 55 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 51.2 bits (117), Expect = 8e-07 Identities = 25/60 (41%), Positives = 41/60 (68%) Frame = -1 Query: 451 LASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGFRRGRSCADSFISLISDL 272 LAS+YRPISL+S KI E +L L ++++N+I+ +Q+GFR+ SC I+++ +L Sbjct: 100 LASNYRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHEL 159 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 + L+ NSCSPGDPLVLERPPPRWS Sbjct: 58 VSRTLLSNSCSPGDPLVLERPPPRWS 83 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 51.2 bits (117), Expect = 8e-07 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -2 Query: 132 DQENKGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 D+ G +Y +Q NSCSPGDPLVLERPPPRWS Sbjct: 28 DKVCSGPYY--LQKKNASNSCSPGDPLVLERPPPRWS 62 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 93 DNLVPNSCSPGDPLVLERPPPRWS 22 D L NSCSPGDPLVLERPPPRWS Sbjct: 21 DALSSNSCSPGDPLVLERPPPRWS 44 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 51.2 bits (117), Expect = 8e-07 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -2 Query: 108 YGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 YG I+ ++ NSCSPGDPLVLERPPPRWS Sbjct: 9 YGLIRP-VLSNSCSPGDPLVLERPPPRWS 36 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N+ NSCSPGDPLVLERPPPRWS Sbjct: 20 NISSNSCSPGDPLVLERPPPRWS 42 >SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 51.2 bits (117), Expect = 8e-07 Identities = 28/88 (31%), Positives = 49/88 (55%) Frame = -1 Query: 535 FTLA*QLYSQAWKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEA 356 F++ + +K VIP+ K A L S+YRPISL +IFE ++ RL+ Y++ Sbjct: 312 FSIESGIVPDKFKIAKVIPVFKKGSALTL-SNYRPISLPPIFNQIFEKLICQRLNHYLQT 370 Query: 355 NHIIPDVQYGFRRGRSCADSFISLISDL 272 ++I+ Q+GFR S + +S++ + Sbjct: 371 HNILYSNQFGFRPKHSTTHAVLSVVDKI 398 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 51.2 bits (117), Expect = 8e-07 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = -2 Query: 138 KKDQENK-GKWYGSIQD----NLVPNSCSPGDPLVLERPPPRWS 22 +K ++NK G Y ++ + N + NSCSPGDPLVLERPPPRWS Sbjct: 29 EKCEKNKVGDEYHTLMECDYVNDISNSCSPGDPLVLERPPPRWS 72 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 51.2 bits (117), Expect = 8e-07 Identities = 25/60 (41%), Positives = 41/60 (68%) Frame = -1 Query: 451 LASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGFRRGRSCADSFISLISDL 272 LAS+YRPISL+S KI E +L L ++++N+I+ +Q+GFR+ SC I+++ +L Sbjct: 585 LASNYRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHEL 644 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 + + L NSCSPGDPLVLERPPPRWS Sbjct: 2 LYNTLASNSCSPGDPLVLERPPPRWS 27 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 +V NSCSPGDPLVLERPPPRWS Sbjct: 11 MVSNSCSPGDPLVLERPPPRWS 32 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 120 KGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 +G G + NSCSPGDPLVLERPPPRWS Sbjct: 2410 RGSDTGGSSSAIASNSCSPGDPLVLERPPPRWS 2442 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 +V NSCSPGDPLVLERPPPRWS Sbjct: 1 MVSNSCSPGDPLVLERPPPRWS 22 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N+ NSCSPGDPLVLERPPPRWS Sbjct: 33 NIPSNSCSPGDPLVLERPPPRWS 55 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 51.2 bits (117), Expect = 8e-07 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 108 YGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 + + ++ + NSCSPGDPLVLERPPPRWS Sbjct: 77 HSGLNEHSLSNSCSPGDPLVLERPPPRWS 105 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 51.2 bits (117), Expect = 8e-07 Identities = 25/60 (41%), Positives = 41/60 (68%) Frame = -1 Query: 451 LASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGFRRGRSCADSFISLISDL 272 LAS+YRPISL+S KI E +L L ++++N+I+ +Q+GFR+ SC I+++ +L Sbjct: 954 LASNYRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHEL 1013 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N+ NSCSPGDPLVLERPPPRWS Sbjct: 15 NISSNSCSPGDPLVLERPPPRWS 37 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 +V NSCSPGDPLVLERPPPRWS Sbjct: 1 MVSNSCSPGDPLVLERPPPRWS 22 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 ++ +V NSCSPGDPLVLERPPPRWS Sbjct: 22 TVIQKVVSNSCSPGDPLVLERPPPRWS 48 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 IQ + NSCSPGDPLVLERPPPRWS Sbjct: 63 IQKIKISNSCSPGDPLVLERPPPRWS 88 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -2 Query: 96 QDNLVPNSCSPGDPLVLERPPPRWS 22 + L NSCSPGDPLVLERPPPRWS Sbjct: 8 ESGLTSNSCSPGDPLVLERPPPRWS 32 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = -2 Query: 138 KKDQENKGKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 KK E++ + + NSCSPGDPLVLERPPPRWS Sbjct: 16 KKPDESEADIEAKQRMEYLSNSCSPGDPLVLERPPPRWS 54 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 ++ NSCSPGDPLVLERPPPRWS Sbjct: 17 IISNSCSPGDPLVLERPPPRWS 38 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -2 Query: 96 QDNLVPNSCSPGDPLVLERPPPRWS 22 Q + NSCSPGDPLVLERPPPRWS Sbjct: 19 QTRVTSNSCSPGDPLVLERPPPRWS 43 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 IQ + NSCSPGDPLVLERPPPRWS Sbjct: 5 IQIRGISNSCSPGDPLVLERPPPRWS 30 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -2 Query: 108 YGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 Y S + ++ NSCSPGDPLVLERPPPRWS Sbjct: 48 YLSPLEPILSNSCSPGDPLVLERPPPRWS 76 >SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) Length = 252 Score = 50.8 bits (116), Expect = 1e-06 Identities = 28/88 (31%), Positives = 49/88 (55%) Frame = -1 Query: 535 FTLA*QLYSQAWKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEA 356 F++ + +K VIP+ K A L S+YRPISL +IFE ++ RL+ Y++ Sbjct: 5 FSIESGIVPDKFKIAKVIPVFKKGSALTL-SNYRPISLLPIFNQIFEKLICQRLNHYLQT 63 Query: 355 NHIIPDVQYGFRRGRSCADSFISLISDL 272 ++I+ Q+GFR S + +S++ + Sbjct: 64 HNILYSNQFGFRPKHSTTHAVLSVVDKI 91 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 + D+ NSCSPGDPLVLERPPPRWS Sbjct: 24 VHDHNQSNSCSPGDPLVLERPPPRWS 49 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 +V NSCSPGDPLVLERPPPRWS Sbjct: 3474 VVSNSCSPGDPLVLERPPPRWS 3495 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 ++ NSCSPGDPLVLERPPPRWS Sbjct: 14 IISNSCSPGDPLVLERPPPRWS 35 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 +V NSCSPGDPLVLERPPPRWS Sbjct: 7 VVSNSCSPGDPLVLERPPPRWS 28 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 54 LLSNSCSPGDPLVLERPPPRWS 75 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 2 LLSNSCSPGDPLVLERPPPRWS 23 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 6 LLSNSCSPGDPLVLERPPPRWS 27 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 ++ NSCSPGDPLVLERPPPRWS Sbjct: 5 IISNSCSPGDPLVLERPPPRWS 26 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -2 Query: 111 WYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 W+GS NSCSPGDPLVLERPPPRWS Sbjct: 4 WFGS--GIRTSNSCSPGDPLVLERPPPRWS 31 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 + V NSCSPGDPLVLERPPPRWS Sbjct: 12 SFVSNSCSPGDPLVLERPPPRWS 34 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -2 Query: 93 DNLVPNSCSPGDPLVLERPPPRWS 22 D+ NSCSPGDPLVLERPPPRWS Sbjct: 9 DDRTSNSCSPGDPLVLERPPPRWS 32 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N + NSCSPGDPLVLERPPPRWS Sbjct: 6 NGISNSCSPGDPLVLERPPPRWS 28 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 ++ NSCSPGDPLVLERPPPRWS Sbjct: 1 MISNSCSPGDPLVLERPPPRWS 22 >SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73) Length = 445 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -1 Query: 505 AWKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYG 326 AWK V I K + + RP+SL+S + K+ E ++ + ++ ANHII +Q+G Sbjct: 370 AWKDANVTAIFKKGHRAD-PKNCRPVSLTSLISKVMEHVVCKHVTNHLCANHIITHLQHG 428 Query: 325 FRRGRSCADSFISLISD 275 F++G SC S+I D Sbjct: 429 FQQGLSCETQLTSVIHD 445 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 1 LLSNSCSPGDPLVLERPPPRWS 22 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 ++ NSCSPGDPLVLERPPPRWS Sbjct: 4 IISNSCSPGDPLVLERPPPRWS 25 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/23 (95%), Positives = 22/23 (95%), Gaps = 1/23 (4%) Frame = -2 Query: 87 LVP-NSCSPGDPLVLERPPPRWS 22 LVP NSCSPGDPLVLERPPPRWS Sbjct: 27 LVPSNSCSPGDPLVLERPPPRWS 49 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 +I + V NSCSPGDPLVLERPPPRWS Sbjct: 12 NIANAKVSNSCSPGDPLVLERPPPRWS 38 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L+ NSCSPGDPLVLERPPPRWS Sbjct: 7 LLSNSCSPGDPLVLERPPPRWS 28 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 +L NSCSPGDPLVLERPPPRWS Sbjct: 14 SLTSNSCSPGDPLVLERPPPRWS 36 >SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -2 Query: 117 GKWYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 GK + S++ + NSCSPGDPLVLERPPPRWS Sbjct: 3 GKTHDSLESS---NSCSPGDPLVLERPPPRWS 31 >SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 50.8 bits (116), Expect = 1e-06 Identities = 28/88 (31%), Positives = 49/88 (55%) Frame = -1 Query: 535 FTLA*QLYSQAWKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEA 356 F++ + +K VIP+ K A L S+YRPISL +IFE ++ RL+ Y++ Sbjct: 5 FSIESGIVPDKFKIAKVIPVFKKGSALTL-SNYRPISLLPIFNQIFEKLICQRLNHYLQT 63 Query: 355 NHIIPDVQYGFRRGRSCADSFISLISDL 272 ++I+ Q+GFR S + +S++ + Sbjct: 64 HNILYSNQFGFRPKHSTTHAVLSVVDKI 91 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 + V NSCSPGDPLVLERPPPRWS Sbjct: 15 DFVSNSCSPGDPLVLERPPPRWS 37 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 ++ NSCSPGDPLVLERPPPRWS Sbjct: 26 IISNSCSPGDPLVLERPPPRWS 47 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I+ L NSCSPGDPLVLERPPPRWS Sbjct: 92 IKRALASNSCSPGDPLVLERPPPRWS 117 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 30 VSNSCSPGDPLVLERPPPRWS 50 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 ++D NSCSPGDPLVLERPPPRWS Sbjct: 1 MRDGGASNSCSPGDPLVLERPPPRWS 26 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 10 VSNSCSPGDPLVLERPPPRWS 30 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 15 VSNSCSPGDPLVLERPPPRWS 35 >SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 50.4 bits (115), Expect = 1e-06 Identities = 29/82 (35%), Positives = 42/82 (51%) Frame = -1 Query: 514 YSQAWKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDV 335 Y +W ++PILK P ++R I+L S LGK+F +++ RL Y+ II Sbjct: 886 YPSSWSYGLIVPILKKGD-PSKPENFRGITLLSSLGKVFTSIMNNRLYNYLVERKIIKPE 944 Query: 334 QYGFRRGRSCADSFISLISDLD 269 Q GFR+ DS L S +D Sbjct: 945 QGGFRKEHGTVDSIFILKSLID 966 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 2 VSNSCSPGDPLVLERPPPRWS 22 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -2 Query: 105 GSIQDNLVPNSCSPGDPLVLERPPPRWS 22 GS+ + NSCSPGDPLVLERPPPRWS Sbjct: 28 GSVIIASLSNSCSPGDPLVLERPPPRWS 55 >SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) Length = 469 Score = 50.4 bits (115), Expect = 1e-06 Identities = 29/82 (35%), Positives = 42/82 (51%) Frame = -1 Query: 514 YSQAWKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDV 335 Y +W ++PILK P ++R I+L S LGK+F +++ RL Y+ II Sbjct: 183 YPSSWSYGLIVPILKKGD-PSKPENFRGITLLSSLGKVFTSIMNNRLYNYLVERKIIKPE 241 Query: 334 QYGFRRGRSCADSFISLISDLD 269 Q GFR+ DS L S +D Sbjct: 242 QGGFRKEHGTVDSIFILKSLID 263 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 15 LTSNSCSPGDPLVLERPPPRWS 36 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 40 VSNSCSPGDPLVLERPPPRWS 60 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 184 VSNSCSPGDPLVLERPPPRWS 204 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 34 VSNSCSPGDPLVLERPPPRWS 54 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 ++ NSCSPGDPLVLERPPPRWS Sbjct: 14 VISNSCSPGDPLVLERPPPRWS 35 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 78 LTSNSCSPGDPLVLERPPPRWS 99 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 3 VSNSCSPGDPLVLERPPPRWS 23 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 105 GSIQDNLVPNSCSPGDPLVLERPPPRWS 22 G+ Q NSCSPGDPLVLERPPPRWS Sbjct: 25 GNGQKKNASNSCSPGDPLVLERPPPRWS 52 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 214 VSNSCSPGDPLVLERPPPRWS 234 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 32 VSNSCSPGDPLVLERPPPRWS 52 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 5 LASNSCSPGDPLVLERPPPRWS 26 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 5 VSNSCSPGDPLVLERPPPRWS 25 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 3 VSNSCSPGDPLVLERPPPRWS 23 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 7 VSNSCSPGDPLVLERPPPRWS 27 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 64 VSNSCSPGDPLVLERPPPRWS 84 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 4 VSNSCSPGDPLVLERPPPRWS 24 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -2 Query: 93 DNLVPNSCSPGDPLVLERPPPRWS 22 D + NSCSPGDPLVLERPPPRWS Sbjct: 20 DRHLSNSCSPGDPLVLERPPPRWS 43 >SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -2 Query: 99 IQDNLVPNSCSPGDPLVLERPPPRWS 22 I D+L NSCSPGDPLVLERPPPRWS Sbjct: 2 INDDL-SNSCSPGDPLVLERPPPRWS 26 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 19 VSNSCSPGDPLVLERPPPRWS 39 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 4 VSNSCSPGDPLVLERPPPRWS 24 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 25 VSNSCSPGDPLVLERPPPRWS 45 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 17 LASNSCSPGDPLVLERPPPRWS 38 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 10 VSNSCSPGDPLVLERPPPRWS 30 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 59 VSNSCSPGDPLVLERPPPRWS 79 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 31 VSNSCSPGDPLVLERPPPRWS 51 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/44 (54%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -2 Query: 150 RELWKKDQENKGKWYGSI-QDNLVPNSCSPGDPLVLERPPPRWS 22 R W K +E K ++ NSCSPGDPLVLERPPPRWS Sbjct: 24 RHCWPKGREFLAKRARYCWPKDIASNSCSPGDPLVLERPPPRWS 67 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N + NSCSPGDPLVLERPPPRWS Sbjct: 22 NNLSNSCSPGDPLVLERPPPRWS 44 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -2 Query: 150 RELWKKDQENKGKWYGSIQDNL-VPNSCSPGDPLVLERPPPRWS 22 R LW D E ++ G I + NSCSPGDPLVLERPPPRWS Sbjct: 39 RLLWY-DVERGDEYGGEILAAFELSNSCSPGDPLVLERPPPRWS 81 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 4 VSNSCSPGDPLVLERPPPRWS 24 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 41 VSNSCSPGDPLVLERPPPRWS 61 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 15 VSNSCSPGDPLVLERPPPRWS 35 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 4 VSNSCSPGDPLVLERPPPRWS 24 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 96 QDNLVPNSCSPGDPLVLERPPPRWS 22 + + NSCSPGDPLVLERPPPRWS Sbjct: 43 ESTITSNSCSPGDPLVLERPPPRWS 67 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 6 VSNSCSPGDPLVLERPPPRWS 26 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 15 VSNSCSPGDPLVLERPPPRWS 35 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 37 LTSNSCSPGDPLVLERPPPRWS 58 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 18 VSNSCSPGDPLVLERPPPRWS 38 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 20 LASNSCSPGDPLVLERPPPRWS 41 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 11 LTSNSCSPGDPLVLERPPPRWS 32 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -2 Query: 108 YGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 + S+ N NSCSPGDPLVLERPPPRWS Sbjct: 3 FKSLIHNHKSNSCSPGDPLVLERPPPRWS 31 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 30 VSNSCSPGDPLVLERPPPRWS 50 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 32 VSNSCSPGDPLVLERPPPRWS 52 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 10 VSNSCSPGDPLVLERPPPRWS 30 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 17 VSNSCSPGDPLVLERPPPRWS 37 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 14 VSNSCSPGDPLVLERPPPRWS 34 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 34 VSNSCSPGDPLVLERPPPRWS 54 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 88 LTSNSCSPGDPLVLERPPPRWS 109 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 11 LASNSCSPGDPLVLERPPPRWS 32 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 ++ NSCSPGDPLVLERPPPRWS Sbjct: 17 VISNSCSPGDPLVLERPPPRWS 38 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 8 VSNSCSPGDPLVLERPPPRWS 28 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 10 VSNSCSPGDPLVLERPPPRWS 30 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 11 LASNSCSPGDPLVLERPPPRWS 32 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 3 LASNSCSPGDPLVLERPPPRWS 24 >SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) Length = 401 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/88 (31%), Positives = 49/88 (55%) Frame = -1 Query: 535 FTLA*QLYSQAWKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEA 356 F++ + +K VIP+ K A L S+YRPISL +IFE ++ RL+ Y++ Sbjct: 216 FSIESGIVPDKFKIAKVIPVFKKGSAFTL-SNYRPISLLPIFNQIFEKLICQRLNHYLQT 274 Query: 355 NHIIPDVQYGFRRGRSCADSFISLISDL 272 ++I+ Q+GFR S + +S++ + Sbjct: 275 HNILYSNQFGFRPKHSTTHAVLSVVDKI 302 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 661 LASNSCSPGDPLVLERPPPRWS 682 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 27 VSNSCSPGDPLVLERPPPRWS 47 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 7 LASNSCSPGDPLVLERPPPRWS 28 >SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 90 NLVPNSCSPGDPLVLERPPPRWS 22 N+ NSCSPGDPLVLERPPPRWS Sbjct: 3 NVGSNSCSPGDPLVLERPPPRWS 25 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 193 VSNSCSPGDPLVLERPPPRWS 213 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 V NSCSPGDPLVLERPPPRWS Sbjct: 9 VSNSCSPGDPLVLERPPPRWS 29 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -2 Query: 111 WYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 + G ++ NSCSPGDPLVLERPPPRWS Sbjct: 41 YLGEMEVTHTSNSCSPGDPLVLERPPPRWS 70 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 ++ NSCSPGDPLVLERPPPRWS Sbjct: 25 VISNSCSPGDPLVLERPPPRWS 46 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 111 WYGSIQDNLVPNSCSPGDPLVLERPPPRWS 22 WY + + NSCSPGDPLVLERPPPRWS Sbjct: 585 WYPRVG---ISNSCSPGDPLVLERPPPRWS 611 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 87 LVPNSCSPGDPLVLERPPPRWS 22 L NSCSPGDPLVLERPPPRWS Sbjct: 4 LASNSCSPGDPLVLERPPPRWS 25 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 + NSCSPGDPLVLERPPPRWS Sbjct: 5 ISNSCSPGDPLVLERPPPRWS 25 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 + NSCSPGDPLVLERPPPRWS Sbjct: 101 ISNSCSPGDPLVLERPPPRWS 121 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = -2 Query: 102 SIQDNLVPNSCSPGDPLVLERPPPRWS 22 +I ++ NSCSPGDPLVLERPPPRWS Sbjct: 7 NIANSHTSNSCSPGDPLVLERPPPRWS 33 >SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) Length = 969 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/60 (41%), Positives = 40/60 (66%) Frame = -1 Query: 451 LASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPDVQYGFRRGRSCADSFISLISDL 272 LAS+YRPISL+S KI E +L L ++++N+I+ +Q+GFR+ SC I+++ L Sbjct: 729 LASNYRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHKL 788 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 + NSCSPGDPLVLERPPPRWS Sbjct: 261 ISNSCSPGDPLVLERPPPRWS 281 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 + NSCSPGDPLVLERPPPRWS Sbjct: 16 ISNSCSPGDPLVLERPPPRWS 36 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 50.0 bits (114), Expect = 2e-06 Identities = 28/83 (33%), Positives = 44/83 (53%) Frame = -1 Query: 517 LYSQAWKTQCVIPILKPDKAPELASSYRPISLSSCLGKIFETMLKVRLDWYVEANHIIPD 338 ++ Q W +IPI K ++ ++YR I+L SCL K+F ++L RL Y+ + Sbjct: 1322 VFPQEWNLGFIIPIFKKGDRSDV-NNYRGITLLSCLSKLFTSILNSRLYDYLVQKGYLKK 1380 Query: 337 VQYGFRRGRSCADSFISLISDLD 269 Q GFR+ S DS L + +D Sbjct: 1381 EQGGFRKKHSTVDSIFILKTVID 1403 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/28 (78%), Positives = 24/28 (85%), Gaps = 1/28 (3%) Frame = -2 Query: 102 SIQDNL-VPNSCSPGDPLVLERPPPRWS 22 S +D L + NSCSPGDPLVLERPPPRWS Sbjct: 16 SSKDRLELSNSCSPGDPLVLERPPPRWS 43 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 + NSCSPGDPLVLERPPPRWS Sbjct: 21 ISNSCSPGDPLVLERPPPRWS 41 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 + NSCSPGDPLVLERPPPRWS Sbjct: 59 ISNSCSPGDPLVLERPPPRWS 79 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 + NSCSPGDPLVLERPPPRWS Sbjct: 9 ISNSCSPGDPLVLERPPPRWS 29 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 84 VPNSCSPGDPLVLERPPPRWS 22 + NSCSPGDPLVLERPPPRWS Sbjct: 3 ISNSCSPGDPLVLERPPPRWS 23 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,186,849 Number of Sequences: 59808 Number of extensions: 455287 Number of successful extensions: 3654 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3616 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -