BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060170.seq (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 3.1 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 3.1 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 3.1 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 3.1 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 3.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 3.1 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 3.1 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 3.1 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 9.5 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 9.5 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 483 LSTQRPRPRCVTMVTASSNFRGKKTSLSIQPVSADSCP 596 LST PR ++ SN K+S P+S + P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 483 LSTQRPRPRCVTMVTASSNFRGKKTSLSIQPVSADSCP 596 LST PR ++ SN K+S P+S + P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 483 LSTQRPRPRCVTMVTASSNFRGKKTSLSIQPVSADSCP 596 LST PR ++ SN K+S P+S + P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 483 LSTQRPRPRCVTMVTASSNFRGKKTSLSIQPVSADSCP 596 LST PR ++ SN K+S P+S + P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 483 LSTQRPRPRCVTMVTASSNFRGKKTSLSIQPVSADSCP 596 LST PR ++ SN K+S P+S + P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 483 LSTQRPRPRCVTMVTASSNFRGKKTSLSIQPVSADSCP 596 LST PR ++ SN K+S P+S + P Sbjct: 72 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 109 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 483 LSTQRPRPRCVTMVTASSNFRGKKTSLSIQPVSADSCP 596 LST PR ++ SN K+S P+S + P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 483 LSTQRPRPRCVTMVTASSNFRGKKTSLSIQPVSADSCP 596 LST PR ++ SN K+S P+S + P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 483 LSTQRPRPRCVTMVTASSNFRGKKTSLSIQPVSADSCP 596 LST PR ++ SN K+S P+S + P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -2 Query: 247 DKVTCFITACSGREKEDGS 191 DK+ CF + +G +GS Sbjct: 24 DKILCFFASWAGYRNGEGS 42 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +1 Query: 598 SILXCQDTPFVKFTYDAEVTG 660 + L CQD F F Y + G Sbjct: 341 NFLQCQDEKFESFVYYHRILG 361 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,329 Number of Sequences: 336 Number of extensions: 2940 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -