BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060170.seq (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 28 0.32 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 5.2 AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 prote... 24 5.2 AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. 24 5.2 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 27.9 bits (59), Expect = 0.32 Identities = 25/91 (27%), Positives = 43/91 (47%) Frame = +3 Query: 24 LKTSFFRNKIAFFVPVRLINWKHSKVRHSLINFGLHTKQTRSRFSQVPVMGAFSPLDPSS 203 + T RNKIA FV + +HS+VR I+ L ++ R + VP + A D Sbjct: 41 IPTKPLRNKIAGFVTHLMKRLRHSQVRG--ISIKLQEEERERRDNYVPDVSALEQ-DIIE 97 Query: 204 FSRPEQAVIKHVTLSLNWILKTKS*TDPPLS 296 + ++KH+ + N +++ + T P S Sbjct: 98 VDPETKEMLKHLDFN-NIVVQLTNPTAPGYS 127 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 5.2 Identities = 14/60 (23%), Positives = 27/60 (45%) Frame = +2 Query: 395 LDDPVPNYGSKLTIQLPKRASSGDKLKIKIKYTTSPSALRYNGYSQLKLSGEENILIYSA 574 LD + +G T+ + + S +++ Y L Y+G+ GE + L+Y+A Sbjct: 3156 LDGMISCFGHSSTVTIIPKFESNPRIENADHYKYC-MPLTYDGHPSASCEGEWSSLVYTA 3214 >AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 protein protein. Length = 165 Score = 23.8 bits (49), Expect = 5.2 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 269 CFQNPVQR*SHMFYYSLFRPRKGRRIQR 186 C Q P +H+FY L + GR ++ Sbjct: 102 CVQVPTSERAHVFYKCLLKSTTGRTFKK 129 >AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. Length = 165 Score = 23.8 bits (49), Expect = 5.2 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 269 CFQNPVQR*SHMFYYSLFRPRKGRRIQR 186 C Q P +H+FY L + GR ++ Sbjct: 102 CVQVPTSERAHVFYKCLLKSTTGRTFKK 129 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,318 Number of Sequences: 2352 Number of extensions: 11945 Number of successful extensions: 71 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -