BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060169.seq (665 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 1.3 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 3.0 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 9.1 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 355 GSCCKICDSTSSIIWINLN 299 G CC IC + +S++ N N Sbjct: 726 GECCAICVNATSLVESNRN 744 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 446 NITAVTKLLYYALRCFV*CPR 384 NIT V K +++ + F+ CPR Sbjct: 5 NITDVLKHVWFLSKLFLLCPR 25 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +3 Query: 375 FPPPWTLHEATQCIIKKFSHCCYVVDAANKL 467 FPPP+ + T ++ + + AA+ L Sbjct: 206 FPPPYPFYPGTSAMLAAYQRYNPYLQAASML 236 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,525 Number of Sequences: 336 Number of extensions: 3402 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -