BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060169.seq (665 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 6.5 Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein... 23 8.7 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.4 bits (48), Expect = 6.5 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 249 TQTVIEEHLSMRCEEWLFRFIQIMEEVLSQILQQDPHFV 365 TQT +E + R + FRFI V LQ + H + Sbjct: 268 TQTPLEVYTVRRGARFRFRFINAASHVCPLQLQIEDHMM 306 >Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein protein. Length = 401 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 215 RNLFSVTLWLIYPDGHRRTPFNEMRRMAIQIYPNNGGSA 331 R LF + L GHR ++ + A Q P GG A Sbjct: 288 RRLFEIAS-LFKAKGHRFAAIEQLLKWAHQYAPMRGGKA 325 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,426 Number of Sequences: 2352 Number of extensions: 12166 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -