BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060169.seq (665 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 27 0.21 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 27 0.21 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 6.0 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 6.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 6.0 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 6.0 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 8.0 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 26.6 bits (56), Expect = 0.21 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 273 LSMRCEEWLFRFIQIMEEVLSQILQQDPHFVNSEFPPPWTLHEATQCI 416 L CE+ +EEV S +L+ P F +S PP +H++ C+ Sbjct: 446 LHTECEDLSVSGEAGIEEVKSPVLRSPPAFSHSRCPP--EIHKSCICV 491 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 26.6 bits (56), Expect = 0.21 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 273 LSMRCEEWLFRFIQIMEEVLSQILQQDPHFVNSEFPPPWTLHEATQCI 416 L CE+ +EEV S +L+ P F +S PP +H++ C+ Sbjct: 446 LHTECEDLSVSGEAGIEEVKSPVLRSPPAFSHSRCPP--EIHKSCICV 491 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/45 (26%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +3 Query: 252 QTVIEEHLSMRCEEWLFR----FIQIMEEVLSQILQQDPHFVNSE 374 Q+ IE L M +++F ++ + E + Q DP+F+N++ Sbjct: 40 QSWIESRLDM--PDYIFEEGDDYVTLPPEFFDSLWQPDPYFLNAK 82 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = -2 Query: 109 YYYQEHDLK*LHCSCYYNQQYRLSFL 32 Y Y ++ K L+C+ Y Y ++++ Sbjct: 89 YNYNNNNYKKLYCNNYKKLYYNINYI 114 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = -2 Query: 109 YYYQEHDLK*LHCSCYYNQQYRLSFL 32 Y Y ++ K L+C+ Y Y ++++ Sbjct: 89 YNYNNNNYKKLYCNNYKKLYYNINYI 114 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = -2 Query: 109 YYYQEHDLK*LHCSCYYNQQYRLSFL 32 Y Y ++ K L+C+ Y Y ++++ Sbjct: 89 YNYNNNNYKKLYCNNYRKLYYNINYI 114 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 452 VYNITAVTKLLYYALRCFV*C 390 V+NIT K L+Y + + C Sbjct: 227 VFNITLRRKTLFYTVNLIIPC 247 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,190 Number of Sequences: 438 Number of extensions: 3667 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -