BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060163.seq (563 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0316 + 4251465-4251590,4251664-4251719,4252973-4253087,425... 30 1.5 07_01_0846 + 6873655-6873783,6875175-6875368,6875923-6876007,687... 27 7.8 06_03_1457 - 30287185-30287287,30287691-30287759,30288212-302883... 27 7.8 03_01_0016 + 131141-131236,131743-132043,132125-132341,132440-13... 27 7.8 >04_01_0316 + 4251465-4251590,4251664-4251719,4252973-4253087, 4253174-4253417,4254189-4254325,4255006-4255065, 4255336-4255460,4256021-4256048,4256267-4256336, 4256513-4256565,4256966-4257025,4257498-4257544, 4257617-4257741,4258572-4258686,4258778-4258826, 4260415-4260471,4261126-4261209,4261363-4261442, 4262005-4262094,4262252-4262375 Length = 614 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 58 VKIGEFKFGEDTFTLRYVLEQGNLQVKFVAKDIASS 165 V+ G FK ED + L++ N++ +FVA ++ +S Sbjct: 332 VRCGNFKISEDYQAVNVTLKKDNMRTEFVAAEVDNS 367 >07_01_0846 + 6873655-6873783,6875175-6875368,6875923-6876007, 6876041-6876241,6876546-6876644,6876938-6876976 Length = 248 Score = 27.5 bits (58), Expect = 7.8 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = -1 Query: 305 LQVQWVTLLDHVVWSRGYGIDPDSLYVVLYFLSTLTITACLQFTYFKLLAMSLATN 138 L V W L H +W+ I P+ Y L+ LS L + +Q F + + ++++ Sbjct: 95 LDVAWFILFSHAIWN----ITPEEKYGQLFVLS-LKLALWMQIIGFSMYRLGVSSS 145 >06_03_1457 - 30287185-30287287,30287691-30287759,30288212-30288351, 30288447-30288641,30288743-30289363,30289688-30290257, 30290332-30293638,30293764-30293863,30293978-30295014, 30295256-30295604,30296299-30296374,30296456-30297022, 30297094-30297238,30298281-30298405,30298491-30298582, 30298646-30298828,30298946-30299058,30299499-30299649, 30299720-30299882 Length = 2701 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -3 Query: 273 RCLEPGLWYR-PRLAVRRFVF 214 RC +P LW R P LA RR V+ Sbjct: 1863 RCTQPSLWAREPLLAFRRMVY 1883 >03_01_0016 + 131141-131236,131743-132043,132125-132341,132440-132773, 132883-132996,133065-133193,133293-133469,133555-133746, 134844-134981,135327-135559,135900-136003,136633-136727, 136817-137053,137801-137922,138252-138354,138750-138826, 138909-139017,139107-139253,139953-140000,140292-140492, 140589-140738,140917-141002,141088-141193,141278-141373, 141759-141911,142647-142819,142923-142986,144056-144193, 144548-144595,144690-144836,144907-144968,146540-146645, 147357-147461,147548-147679,147765-147974,148070-148171, 148261-148398 Length = 1729 Score = 27.5 bits (58), Expect = 7.8 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = +1 Query: 106 YVLEQGNLQVKF----VAKDIASSLKYVNCKQAVIV 201 Y LE N +K +A+ IA +L Y NCK+ + V Sbjct: 1174 YALESDNNTIKSSVHSIARTIAGNLAYANCKEPLCV 1209 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,549,457 Number of Sequences: 37544 Number of extensions: 314873 Number of successful extensions: 710 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -