BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060163.seq (563 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 25 1.3 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 25 1.3 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 25 1.3 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 25 1.3 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 23 5.2 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 6.9 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.1 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 9.1 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 413 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 502 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 413 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 502 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 413 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 502 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 413 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 502 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 23.4 bits (48), Expect = 5.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 245 DPDSLYVVLYFLSTLTIT 192 +P +L +VL FLS LT+T Sbjct: 6 EPRALGIVLAFLSVLTLT 23 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.0 bits (47), Expect = 6.9 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +3 Query: 330 EGVIQLIMKSKLPYAVELQAWLLEEVIPQCCARASTRRPSRWTQI 464 EGV ++ + P E+++ LL+ V+P+ + P+ W+ + Sbjct: 964 EGVEHVMFEC--PRFAEVRSELLDGVLPETLEAHMLQSPTNWSNV 1006 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 534 FFVGLGQTLLANANFLFNSSIT 469 +FVG+G +L A+ + S IT Sbjct: 2787 YFVGMGLSLSASIGVMIGSGIT 2808 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -3 Query: 258 GLWYRPRLAVRRFVFFVNINYHSLFTI 178 G+ R ++++ FF+NI +LFT+ Sbjct: 270 GILRRSSMSMKDRNFFINITLFALFTL 296 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,051 Number of Sequences: 2352 Number of extensions: 11073 Number of successful extensions: 24 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -