BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060162.seq (664 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 5.2 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 9.0 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.8 bits (44), Expect = 5.2 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 491 NAALINMRAVWKTLICPRTCKIVSRSATRSFWIAYVKGRVXXLK 622 N L ++ + L C + K ++ A + FW Y + LK Sbjct: 362 NNELFHLGSDEVNLTCWQDTKSANKIAMKLFWAQYTNKMIDRLK 405 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.0 bits (42), Expect = 9.0 Identities = 6/27 (22%), Positives = 13/27 (48%) Frame = -3 Query: 401 LCVSNLICVRIFAAPTTRGYCXFWIFL 321 + L +++FA G+C W+ + Sbjct: 156 IAAKGLPTLKLFALHEFYGFCYLWVLI 182 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,673 Number of Sequences: 336 Number of extensions: 2936 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -