BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060162.seq (664 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0095 - 11076493-11077644,11077845-11077918,11078155-11078320 29 3.3 04_04_0075 - 22542486-22542882,22543181-22543362,22543452-225436... 29 4.4 >01_02_0095 - 11076493-11077644,11077845-11077918,11078155-11078320 Length = 463 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -3 Query: 200 N*NNFPIQFVAKHVNKIGASVTFARYALPKRVIXXIEXIDXXXGXFDG 57 N ++ +Q + VN G S+T+ARYAL ++ + I+ F G Sbjct: 73 NFSHMEVQLMDWMVNTKGMSMTYARYALHLELLYSVYGIEAAEEYFSG 120 >04_04_0075 - 22542486-22542882,22543181-22543362,22543452-22543637, 22543959-22544057,22546198-22546314,22547739-22547855 Length = 365 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 300 NASIKSCVKNFCSDTT 253 N+SI SC+KNFCS T Sbjct: 205 NSSITSCLKNFCSTET 220 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,849,222 Number of Sequences: 37544 Number of extensions: 291343 Number of successful extensions: 548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -