BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060160.seq (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1392 - 26238885-26239007,26239137-26239235,26239636-262397... 28 5.8 06_01_0317 + 2281564-2283855 28 7.7 >07_03_1392 - 26238885-26239007,26239137-26239235,26239636-26239720, 26239825-26240028,26240360-26240682,26241904-26242575 Length = 501 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = -1 Query: 324 DTKKISKIPLQPNVYKTTFFYLTIKRNENAVMTRLIFKISSC--CPFSD 184 DT K I + P+ + FYL K NE+ + + ++F +S+C C + D Sbjct: 291 DTLKQLYIHVPPDAKELYLFYLLSKMNEDNIRSVIVF-VSTCRTCQYLD 338 >06_01_0317 + 2281564-2283855 Length = 763 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/35 (25%), Positives = 25/35 (71%) Frame = +2 Query: 140 SNHRLTNAVEIFDILSLNGQQLDILNIRRVITAFS 244 ++ + + AVE+F+ L +NG+++ + + +++ AF+ Sbjct: 241 THEKFSEAVELFNSLMMNGEEVTNVILVKIVNAFA 275 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,959,008 Number of Sequences: 37544 Number of extensions: 208321 Number of successful extensions: 360 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -