BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060160.seq (666 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 30 0.057 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 23 8.7 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 30.3 bits (65), Expect = 0.057 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -2 Query: 407 QSHLFTFYDYFKLFYIPFIFI*PLLNTKTQKKLAKFRSNRMSI 279 Q+ +F F D+ +F +PF I +LNT T + KF S R ++ Sbjct: 280 QAAMFNFLDFILVFVVPFTII-VVLNTITALTVWKFASIRRTM 321 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 23.0 bits (47), Expect = 8.7 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 571 TMSASNGKRIFQIGPVVSEPIET 503 T++ S G+R +GP SE + + Sbjct: 509 TIAGSTGERFQDLGPAASESVRS 531 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 543,693 Number of Sequences: 2352 Number of extensions: 8947 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -