BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060157.seq (676 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 24 1.3 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 4.0 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +3 Query: 408 KRSTPYALRSPSKWSRNNKRTTCTSSSPYTDGWFTLHHPRP 530 +++TPY+ P+ + + +T T SP + W P P Sbjct: 292 QQATPYSAPGPTYSTWSTVQTPTTVMSPTINCWSLTSSPPP 332 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +2 Query: 140 VTIFKRNEENRSLALRTTPGGEMSVMQKR 226 VT+ +N ++ ++ GG +V Q R Sbjct: 141 VTVVSKNNDDEQYVWESSAGGSFTVTQDR 169 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,619 Number of Sequences: 336 Number of extensions: 3031 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -